• Gene id: 2926

Gene Summary

• Gene Symbol: GRSF1   Gene   UCSC   Ensembl
• Gene name: G-rich RNA sequence binding factor 1
• Alternate names: G-rich sequence factor 1,
• Gene location: 4q13.3 (70843273: 70815782)     Exons: 12     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a cellular protein that binds RNAs containing the G-rich element. The protein is localized in the cytoplasm, and has been shown to stimulate translation of viral mRNAs in vitro. Multiple transcript variants encoding dif
• OMIM: 604851

Protein Summary

• Protein general information: Q12849  
  • Name: G rich sequence factor 1 (GRSF 1)
  • Length: 480  
  • Mass: 53126
• Sequence:

  MAGTRWVLGALLRGCGCNCSSCRRTGAACLPFYSAAGSIPSGVSGRRRLLLLLGAAAAAASQTRGLQTGPVPPGR
  LAGPPAVATSAAAAAAASYSALRASLLPQSLAAAAAVPTRSYSQESKTTYLEDLPPPPEYELAPSKLEEEVDDVF
  LIRAQGLPWSCTMEDVLNFFSDCRIRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEVY
  EINNEDVDALMKSLQVKSSPVVNDGVVRLRGLPYSCNEKDIVDFFAGLNIVDITFVMDYRGRRKTGEAYVQFEEP
  EMANQALLKHREEIGNRYIEIFPSRRNEVRTHVGSYKGKKIASFPTAKYITEPEMVFEEHEVNEDIQPMTAFESE
  KEIELPKEVPEKLPEAADFGTTSSLHFVHMRGLPFQANAQDIINFFAPLKPVRITMEYSSSGKATGEADVHFETH
  EDAVAAMLKDRSHVHHRYIELFLNSCPKGK

• Structural information:
  • Protein Domains: (122..24-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (250..32-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (401..48-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR034424  IPR033106  IPR034425  IPR034426  IPR012677   IPR035979  IPR000504  
  • Prosite: PS50102
  • CDD: cd12730 cd12505 cd12733
  • PDB: 2LMI 4QU6 4QU7
  • PDBsum: 2LMI 4QU6 4QU7
  • STRING: ENSP00000254799
• Other Databases: GeneCards:  GRSF1  Malacards:  GRSF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0005654	nucleoplasm	IBA	cellular component
GO:0043484	regulation of RNA splicing	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0035770	ribonucleoprotein granule	IDA	cellular component
GO:0042645	mitochondrial nucleoid	IDA	cellular component
GO:0006396	RNA processing	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	TAS	molecular function
GO:0003729	mRNA binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006378	mRNA polyadenylation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0016331	morphogenesis of embryonic epithelium	IEA	biological process
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0000962	positive regulation of mitochondrial RNA catabolic process	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)