• Gene id: 2923

Gene Summary

• Gene Symbol: PDIA3   Gene   UCSC   Ensembl
• Aliases: ER60, ERp57, ERp60, ERp61, GRP57, GRP58, HEL-S-269, HEL-S-93n, HsT17083, P58, PI-PLC
• Gene name: protein disulfide isomerase family A member 3
• Alternate names: protein disulfide-isomerase A3, 58 kDa glucose-regulated protein, 58 kDa microsomal protein, ER protein 57, ER protein 60, disulfide isomerase ER-60, endoplasmic reticulum P58, endoplasmic reticulum resident protein 57, endoplasmic reticulum resident prot,
• Gene location: 15q15.3 (43746391: 43772605)     Exons: 13     NC_000015.10
• Gene summary(Entrez): This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demon
• OMIM: 602046

Protein Summary

• Protein general information: P30101  
  • Name: Protein disulfide isomerase A3 (EC 5.3.4.1) (58 kDa glucose regulated protein) (58 kDa microsomal protein) (p58) (Disulfide isomerase ER 60) (Endoplasmic reticulum resident protein 57) (ER protein 57) (ERp57) (Endoplasmic reticulum resident protein 60) (E
  • Length: 505  
  • Mass: 56,782
• Sequence:

  MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLK
  GIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFIS
  DKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQ
  KMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFA
  VASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESND
  GPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGF
  PTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL

• Structural information:
  • Protein Domains: Thioredoxin (25-133)
    Thioredoxin (343-485)
  • Interpro: IPR005788  IPR005792  IPR036249  IPR017937  IPR013766  
  • Prosite: PS00194 PS51352
  • PDB: 2ALB 2DMM 2H8L 3F8U 6ENY
  • PDBsum: 2ALB 2DMM 2H8L 3F8U 6ENY
  • DIP: 29132
  • STRING: ENSP00000300289
• Other Databases: GeneCards:  PDIA3  Malacards:  PDIA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002474	antigen processing and presentation of peptide antigen via MHC class I	TAS	biological process
GO:0003756	protein disulfide isomerase activity	IEA	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004629	phospholipase C activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006606	protein import into nucleus	TAS	biological process
GO:0006621	protein retention in ER lumen	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0015036	disulfide oxidoreductase activity	TAS	molecular function
GO:0034975	protein folding in endoplasmic reticulum	TAS	biological process
GO:0034976	response to endoplasmic reticulum stress	IBA	biological process
GO:0042470	melanosome	IEA	cellular component
GO:0043209	myelin sheath	IEA	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IEA	biological process
GO:0002474	antigen processing and presentation of peptide antigen via MHC class I	TAS	biological process
GO:0003756	protein disulfide isomerase activity	IEA	molecular function
GO:0003756	protein disulfide isomerase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004629	phospholipase C activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006606	protein import into nucleus	TAS	biological process
GO:0006621	protein retention in ER lumen	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0015036	disulfide oxidoreductase activity	TAS	molecular function
GO:0016853	isomerase activity	IEA	molecular function
GO:0016853	isomerase activity	IEA	molecular function
GO:0034975	protein folding in endoplasmic reticulum	TAS	biological process
GO:0034976	response to endoplasmic reticulum stress	IBA	biological process
GO:0042470	melanosome	IEA	cellular component
GO:0043209	myelin sheath	IEA	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IEA	biological process
GO:0002474	antigen processing and presentation of peptide antigen via MHC class I	TAS	biological process
GO:0003756	protein disulfide isomerase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004629	phospholipase C activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0006606	protein import into nucleus	TAS	biological process
GO:0006621	protein retention in ER lumen	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0015036	disulfide oxidoreductase activity	TAS	molecular function
GO:0034975	protein folding in endoplasmic reticulum	TAS	biological process
GO:0034976	response to endoplasmic reticulum stress	IBA	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04612	Antigen processing and presentation
hsa05170	Human immunodeficiency virus 1 infection
hsa05168	Herpes simplex virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05169	Epstein-Barr virus infection

Diseases

Associated diseases	References
Cancer (prostate)	GAD: 19064571
Cancer	GAD: 19064571
Obesity	INFBASE: 25293813
Human fertilization capacity	INFBASE: 17704119
Asthenozoospermia	MIK: 25293813
Testicular inflammation	MIK: 25205753
Male factor infertility	MIK: 17704119
Azoospermia	MIK: 25205753
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 25293813
Obesity	MIK: 25293813
Azoospermia	MIK: 25205753
Testicular inflammation	MIK: 25205753
Male infertility	MIK: 17704119
Human fertilization capacity	MIK: 17704119
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17704119	Male infertility, Human fertilization capacity				Male infertility
25293813	Asthenozoospermia, Obesity			6 (3 normal spermatozoa, Obesity-associated asthenozoospermia)	Male infertility
25205753	Azoospermia, testicular inflammation			135 (20 normozoospermic men, 14 male blood donors, 14 men with impaired semen quality without symptoms of genital tract infection/inflammation, 26 men with impaired semen quality without symptoms of genital tract infection/inflammation, 16 azoospermic men	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881