• Gene id: 2922

Gene Summary

• Gene Symbol: GRP   Gene   UCSC   Ensembl
• Aliases: BN, GRP-10, preproGRP, proGRP
• Gene name: gastrin releasing peptide
• Alternate names: gastrin-releasing peptide, bombesin, neuromedin C, pre-progastrin releasing peptide, prepro-GRP, testicular tissue protein Li 103,
• Gene location: 18q21.32 (59219187: 59230770)     Exons: 5     NC_000018.10
• Gene summary(Entrez): This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions o
• OMIM: 137260

Protein Summary

• Protein general information: P07492  
  • Name: Gastrin releasing peptide (GRP) [Cleaved into: Neuromedin C (GRP 10)]
  • Length: 148  
  • Mass: 16213
• Sequence:

  MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYI
  RWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ

• Structural information:
  • Interpro: IPR000874  IPR015674  
  • Prosite: PS00257
  • PDB: 2N0B 2N0C 2N0D 2N0E 2N0F 2N0G 2N0H
  • PDBsum: 2N0B 2N0C 2N0D 2N0E 2N0F 2N0G 2N0H
  • STRING: ENSP00000256857
• Other Databases: GeneCards:  GRP  Malacards:  GRP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005184	neuropeptide hormone activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:1900738	positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	ISS	biological process
GO:0090277	positive regulation of peptide hormone secretion	ISS	biological process
GO:0034774	secretory granule lumen	ISS	cellular component
GO:0005184	neuropeptide hormone activity	IEA	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005102	signaling receptor binding	NAS	molecular function
GO:0007165	signal transduction	NAS	biological process
GO:0007218	neuropeptide signaling pathway	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005184	neuropeptide hormone activity	IDA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:1900738	positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0036343	psychomotor behavior	IEA	biological process
GO:0035176	social behavior	IEA	biological process
GO:0043207	response to external biotic stimulus	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray