• Gene id: 2920

Gene Summary

• Gene Symbol: CXCL2   Gene   UCSC   Ensembl
• Aliases: CINC-2a, GRO2, GROb, MGSA-b, MIP-2a, MIP2, MIP2A, SCYB2
• Gene name: C-X-C motif chemokine ligand 2
• Alternate names: C-X-C motif chemokine 2, GRO2 oncogene, MGSA beta, MIP2-alpha, chemokine (C-X-C motif) ligand 2, gro-beta, growth-regulated protein beta, macrophage inflammatory protein 2-alpha, melanoma growth stimulatory activity beta,
• Gene location: 4q13.3 (74099194: 74097039)     Exons: 4     NC_000004.12
• Gene summary(Entrez): This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residue
• OMIM: 139110

Protein Summary

• Protein general information: P19875  
  • Name: C X C motif chemokine 2 (Growth regulated protein beta) (Gro beta) (Macrophage inflammatory protein 2 alpha) (MIP2 alpha) [Cleaved into: GRO beta(5 73) (GRO beta T) (Hematopoietic synergistic factor) (HSF) (SB 251353)]
  • Length: 107  
  • Mass: 11389
• Sequence:

  MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVI
  ATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

• Structural information:
  • Interpro: IPR001089  IPR018048  IPR001811  IPR033899  IPR036048  
  • Prosite: PS00471
  • CDD: cd00273
  • PDB: 1QNK 5OB5
  • PDBsum: 1QNK 5OB5
  • DIP: 5908
  • STRING: ENSP00000427279
• Other Databases: GeneCards:  CXCL2  Malacards:  CXCL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0008009	chemokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0045236	CXCR chemokine receptor binding	IBA	molecular function
GO:0030595	leukocyte chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006952	defense response	IEA	biological process
GO:0008009	chemokine activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0008009	chemokine activity	TAS	molecular function
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002237	response to molecule of bacterial origin	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04621	NOD-like receptor signaling pathway
hsa04668	TNF signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa05146	Amoebiasis
hsa04657	IL-17 signaling pathway
hsa05323	Rheumatoid arthritis
hsa05120	Epithelial cell signaling in Helicobacter pylori infection
hsa05134	Legionellosis
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Cystic fibrosis	PMID:20818377
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881