• Gene id: 2919

Gene Summary

• Gene Symbol: CXCL1   Gene   UCSC   Ensembl
• Aliases: FSP, GRO1, GROa, MGSA, MGSA-a, NAP-3, SCYB1
• Gene name: C-X-C motif chemokine ligand 1
• Alternate names: growth-regulated alpha protein, C-X-C motif chemokine 1, GRO-alpha(1-73), GRO1 oncogene (melanoma growth stimulating activity, alpha), GRO1 oncogene (melanoma growth-stimulating activity), MGSA alpha, chemokine (C-X-C motif) ligand 1 (melanoma growth stimulatin,
• Gene location: 4q13.3 (73869392: 73871307)     Exons: 4     NC_000004.12
• Gene summary(Entrez): This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattra

Protein Summary

• Protein general information: P09341  
  • Name: Growth regulated alpha protein (C X C motif chemokine 1) (GRO alpha(1 73)) (Melanoma growth stimulatory activity) (MGSA) (Neutrophil activating protein 3) (NAP 3) [Cleaved into: GRO alpha(4 73); GRO alpha(5 73); GRO alpha(6 73)]
  • Length: 107  
  • Mass: 11301
• Sequence:

  MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVI
  ATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

• Structural information:
  • Interpro: IPR001089  IPR018048  IPR001811  IPR033899  IPR036048  
  • Prosite: PS00471
  • CDD: cd00273
  • PDB: 1MGS 1MSG 1MSH 1ROD
  • PDBsum: 1MGS 1MSG 1MSH 1ROD
  • DIP: 5896
  • STRING: ENSP00000379110
• Other Databases: GeneCards:  CXCL1  Malacards:  CXCL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0008009	chemokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0045236	CXCR chemokine receptor binding	IBA	molecular function
GO:0030595	leukocyte chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006952	defense response	IEA	biological process
GO:0008009	chemokine activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008009	chemokine activity	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0008047	enzyme activator activity	TAS	molecular function
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0030036	actin cytoskeleton organization	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0035580	specific granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	TAS	molecular function
GO:0043085	positive regulation of catalytic activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04621	NOD-like receptor signaling pathway
hsa04668	TNF signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa05146	Amoebiasis
hsa04657	IL-17 signaling pathway
hsa05323	Rheumatoid arthritis
hsa05120	Epithelial cell signaling in Helicobacter pylori infection
hsa05134	Legionellosis
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Cystic fibrosis	PMID:19597126
Asthma	PMID:20371397
Chronic obstructive pulmonary disease	PMID:20858153
Hyperhomocysteinemia	PMID:11950713
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881