• Gene id: 2918

Gene Summary

• Gene Symbol: GRM8   Gene   UCSC   Ensembl
• Aliases: GLUR8, GPRC1H, MGLUR8, mGlu8
• Gene name: glutamate metabotropic receptor 8
• Alternate names: metabotropic glutamate receptor 8, glutamate receptor, metabotropic 8,
• Gene location: 7q31.33 (127252940: 126438597)     Exons: 24     NC_000007.14
• Gene summary(Entrez): L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbe
• OMIM: 601116

Protein Summary

• Protein general information: O00222  
  • Name: Metabotropic glutamate receptor 8 (mGluR8)
  • Length: 908  
  • Mass: 101741
• Sequence:

  MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGERGVPCGELKKEKGIHR
  LEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEKDASDVKCANGDPPIFTKPDKISGV
  IGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEG
  NYGESGVEAFTQISREIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
  GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFAEFWEENFGCKLGSHG
  KRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMHKDLCPGYIGLCPRMSTIDGKELLGYIRAVN
  FNGSAGTPVTFNENGDAPGRYDIFQYQITNKSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGER
  KKTVKGVPCCWHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATTF
  VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMCFSYAALLTKTNRIHR
  IFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPHIIIDYGEQRTLDPEKARGVLKCDISDLSLI
  CSLGYSILLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLS
  ASVSLGMLYMPKVYIIIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
  ISYSNHSI

• Structural information:
  • Interpro: IPR001828  IPR000337  IPR011500  IPR038550  IPR017978   IPR017979  IPR000162  IPR000144  IPR028082  
  • Prosite: PS00979 PS00980 PS00981 PS50259
  • PDB: 6BSZ 6BT5 6E5V
  • PDBsum: 6BSZ 6BT5 6E5V
  • STRING: ENSP00000344173
• Other Databases: GeneCards:  GRM8  Malacards:  GRM8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001642	group III metabotropic glutamate receptor activity	IBA	molecular function
GO:0001642	group III metabotropic glutamate receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007216	G protein-coupled glutamate receptor signaling pathway	IBA	biological process
GO:0008066	glutamate receptor activity	IBA	molecular function
GO:0051966	regulation of synaptic transmission, glutamatergic	IBA	biological process
GO:0008066	glutamate receptor activity	IMP	molecular function
GO:0004930	G protein-coupled receptor activity	IMP	molecular function
GO:0007196	adenylate cyclase-inhibiting G protein-coupled glutamate receptor signaling pathway	IMP	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007601	visual perception	TAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04072	Phospholipase D signaling pathway
hsa04724	Glutamatergic synapse

Diseases

Associated diseases	References
Attention deficit hyperactivity disorder	PMID:22138692
autistic disorder	PMID:12676915
Multiple sclerosis	PMID:15589052
Schizophrenia	PMID:15211621
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq