• Gene id: 2917

Gene Summary

• Gene Symbol: GRM7   Gene   UCSC   Ensembl
• Aliases: GLUR7, GPRC1G, MGLU7, MGLUR7, PPP1R87
• Gene name: glutamate metabotropic receptor 7
• Alternate names: metabotropic glutamate receptor 7, glutamate receptor, metabotropic 7, protein phosphatase 1, regulatory subunit 87,
• Gene location: 3p26.1 (6861114: 7743037)     Exons: 19     NC_000003.12
• Gene summary(Entrez): L-glutamate is the major excitatory neurotransmitter in the central nervous system, and it activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be pert
• OMIM: 603924

SNPs

rs700519

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000015.10   g.51215771G>A
NC_000015.9   g.51507968G>A
NG_007982.1   g.127828C>T
NM_000103.4   c.790C>T
NM_000103.3   c.790C>T
NM_031226.3   c.790C>T
NM_031226.2   c.790C>T
NM_001347255.2   c.790C>T
NM_001347255.1   c.790C>T
NM_001347256.2   c.790C>T
NM_001347256.1   c.

Protein Summary

• Protein general information: Q14831  
  • Name: Metabotropic glutamate receptor 7 (mGluR7)
  • Length: 915  
  • Mass: 102251
  • Tissue specificity: Expressed in many areas of the brain, especially in the cerebral cortex, hippocampus, and cerebellum. Expression of GRM7 isoforms in non-neuronal tissues appears to be restricted to isoform 3 and isoform 4. {ECO
• Sequence:

  MVQLRKLLRVLTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAKGPSGVPCGDIKRENG
  IHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSLTFVQALIQKDTSDVRCTNGEPPVFVKPEKV
  VGVIGASGSSVSIMVANILRLFQIPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLA
  SEGSYGEKGVESFTQISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAK
  RADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRRNVWFAEYWEENFNCK
  LTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAHALHHMNKDLCADYRGVCPEMEQAGGKKLLK
  YIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTL
  PCKPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAML
  GIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLT
  KTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCD
  ITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTL
  TISMNLSASVALGMLYMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS
  PAAKKKYVSYNNLVI

• Structural information:
  • Interpro: IPR001828  IPR000337  IPR011500  IPR038550  IPR017978   IPR017979  IPR000162  IPR001883  IPR028082  
  • Prosite: PS00979 PS00980 PS00981 PS50259
  • PDB: 3MQ4 5C5C
  • PDBsum: 3MQ4 5C5C
  • STRING: ENSP00000350348
• Other Databases: GeneCards:  GRM7  Malacards:  GRM7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001642	group III metabotropic glutamate receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007216	G protein-coupled glutamate receptor signaling pathway	IBA	biological process
GO:0008066	glutamate receptor activity	IBA	molecular function
GO:0051966	regulation of synaptic transmission, glutamatergic	IBA	biological process
GO:0007196	adenylate cyclase-inhibiting G protein-coupled glutamate receptor signaling pathway	IDA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0031279	regulation of cyclase activity	IEA	biological process
GO:0005938	cell cortex	IDA	cellular component
GO:0070905	serine binding	IDA	molecular function
GO:0010855	adenylate cyclase inhibitor activity	IDA	molecular function
GO:0008066	glutamate receptor activity	IDA	molecular function
GO:0001642	group III metabotropic glutamate receptor activity	IDA	molecular function
GO:0001642	group III metabotropic glutamate receptor activity	IDA	molecular function
GO:0030425	dendrite	IDA	cellular component
GO:0007268	chemical synaptic transmission	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0032279	asymmetric synapse	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0001662	behavioral fear response	IMP	NOT|biological process
GO:0048786	presynaptic active zone	ISS	cellular component
GO:0045211	postsynaptic membrane	ISS	cellular component
GO:0007605	sensory perception of sound	IMP	biological process
GO:0014050	negative regulation of glutamate secretion	ISS	biological process
GO:0043198	dendritic shaft	ISS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04072	Phospholipase D signaling pathway
hsa04724	Glutamatergic synapse

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq