• Gene id: 2915

Gene Summary

• Gene Symbol: GRM5   Gene   UCSC   Ensembl
• Aliases: GPRC1E, MGLUR5, PPP1R86, mGlu5
• Gene name: glutamate metabotropic receptor 5
• Alternate names: metabotropic glutamate receptor 5, glutamate receptor, metabotropic 5, protein phosphatase 1, regulatory subunit 86,
• Gene location: 11q14.2-q14.3 (89065962: 88504575)     Exons: 11     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the G-protein coupled receptor 3 protein family. The encoded protein is a metabatropic glutamate receptor, whose signaling activates a phosphatidylinositol-calcium second messenger system. This protein may be involved in the
• OMIM: 604101

Protein Summary

• Protein general information: P41594  
  • Name: Metabotropic glutamate receptor 5 (mGluR5)
  • Length: 1212  
  • Mass: 132469
• Sequence:

  MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHT
  LERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSSFRSKKPIVGVIGPG
  SSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGE
  SGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
  LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQHRFQCRLEGFPQENS
  KYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCPGYAGLCDAMKPIDGRKLLESLMKTNFTGVS
  GDTILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRK
  GEVSCCWTCTPCKENEYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVV
  FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAG
  SKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLL
  ILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYII
  LAKPERNVRSAFTTSTVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMG
  NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRGLGAGAGAGGSAGGVG
  ATGGAGCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPSPISTLSHRAGSASRTDDDVPSLHSEPVARS
  SSSQGSLMEQISSVVTRFTANISELNSMMLSTAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTG
  GAQPAAGAQAAGDAARESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL
  IIRDYTQSSSSL

• Structural information:
  • Interpro: IPR001828  IPR000337  IPR011500  IPR038550  IPR017978   IPR017979  IPR000162  IPR000202  IPR019588  IPR028082  
  • Prosite: PS00979 PS00980 PS00981 PS50259
  • PDB: 3LMK 4OO9 5CGC 5CGD 6N4X 6N4Y 6N50 6N51 6N52
  • PDBsum: 3LMK 4OO9 5CGC 5CGD 6N4X 6N4Y 6N50 6N51 6N52
  • STRING: ENSP00000306138
• Other Databases: GeneCards:  GRM5  Malacards:  GRM5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990782	protein tyrosine kinase binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006417	regulation of translation	TAS	biological process
GO:0006448	regulation of translational elongation	IGI	biological process
GO:1902938	regulation of intracellular calcium activated chloride channel activity	IGI	biological process
GO:0007611	learning or memory	ISS	biological process
GO:0030296	protein tyrosine kinase activator activity	TAS	molecular function
GO:1904646	cellular response to amyloid-beta	ISS	biological process
GO:1904646	cellular response to amyloid-beta	IGI	biological process
GO:0035584	calcium-mediated signaling using intracellular calcium source	IGI	biological process
GO:0050808	synapse organization	ISS	biological process
GO:0001932	regulation of protein phosphorylation	IGI	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	ISS	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	ISS	biological process
GO:0090647	modulation of age-related behavioral decline	ISS	biological process
GO:0099583	neurotransmitter receptor activity involved in regulation of postsynaptic cytosolic calcium ion concentration	IBA	molecular function
GO:0099553	trans-synaptic signaling by endocannabinoid, modulating synaptic transmission	IBA	biological process
GO:0098839	postsynaptic density membrane	IBA	cellular component
GO:0099530	G protein-coupled receptor activity involved in regulation of postsynaptic membrane potential	IBA	molecular function
GO:0051966	regulation of synaptic transmission, glutamatergic	IBA	biological process
GO:0008066	glutamate receptor activity	IBA	molecular function
GO:0007216	G protein-coupled glutamate receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0008066	glutamate receptor activity	IDA	molecular function
GO:0007216	G protein-coupled glutamate receptor signaling pathway	IMP	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0004930	G protein-coupled receptor activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007206	phospholipase C-activating G protein-coupled glutamate receptor signaling pathway	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007611	learning or memory	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0035584	calcium-mediated signaling using intracellular calcium source	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0050808	synapse organization	IEA	biological process
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0099170	postsynaptic modulation of chemical synaptic transmission	IEA	biological process
GO:0099583	neurotransmitter receptor activity involved in regulation of postsynaptic cytosolic calcium ion concentration	IEA	molecular function
GO:1904646	cellular response to amyloid-beta	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007612	learning	IEA	biological process
GO:0048169	regulation of long-term neuronal synaptic plasticity	IEA	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	IEA	biological process
GO:0090647	modulation of age-related behavioral decline	IEA	biological process
GO:0099530	G protein-coupled receptor activity involved in regulation of postsynaptic membrane potential	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0099566	regulation of postsynaptic cytosolic calcium ion concentration	IEA	biological process
GO:0099566	regulation of postsynaptic cytosolic calcium ion concentration	IEA	biological process
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process
GO:0050890	cognition	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04080	Neuroactive ligand-receptor interaction
hsa05016	Huntington disease
hsa04020	Calcium signaling pathway
hsa04723	Retrograde endocannabinoid signaling
hsa04072	Phospholipase D signaling pathway
hsa04724	Glutamatergic synapse
hsa04540	Gap junction
hsa04720	Long-term potentiation

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq