• Gene id: 29126

Gene Summary

• Gene Symbol: CD274   Gene   UCSC   Ensembl
• Aliases: B7-H, B7H1, PD-L1, PDCD1L1, PDCD1LG1, PDL1, hPD-L1
• Gene name: CD274 molecule
• Alternate names: programmed cell death 1 ligand 1, B7 homolog 1, CD274 antigen, PDCD1 ligand 1,
• Gene location: 9p24.1 (113358575: 113391628)     Exons: 13     NC_000012.12
• Gene summary(Entrez): This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobu
• OMIM: 605402

Protein Summary

• Protein general information: Q9NZQ7  
  • Name: Programmed cell death 1 ligand 1 (PD L1) (PDCD1 ligand 1) (Programmed death ligand 1) (hPD L1) (B7 homolog 1) (B7 H1) (CD antigen CD274)
  • Length: 290  
  • Mass: 33275
  • Tissue specificity: Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes. {ECO
• Sequence:

  MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLK
  VQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSE
  HELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELV
  IPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET

• Structural information:
  • Protein Domains: (19..12-)
    (/note="Ig-like-V-type)
    (133..22-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR013162  IPR007110  IPR036179  IPR013783  IPR003599   IPR013106  
  • Prosite: PS50835
  • PDB: 3BIK 3BIS 3FN3 3SBW 4Z18 4ZQK 5C3T 5GGT 5GRJ 5IUS 5J89 5J8O 5JDR 5JDS 5N2D 5N2F 5NIU 5O45 5O4Y 5X8L 5X8M 5XJ4 5XXY 6NM7 6NM8 6NNV 6NOJ 6NOS 6NP9 6PV9 6R3K 6RPG
  • PDBsum: 3BIK 3BIS 3FN3 3SBW 4Z18 4ZQK 5C3T 5GGT 5GRJ 5IUS 5J89 5J8O 5JDR 5JDS 5N2D 5N2F 5NIU 5O45 5O4Y 5X8L 5X8M 5XJ4 5XXY 6NM7 6NM8 6NNV 6NOJ 6NOS 6NP9 6PV9 6R3K 6RPG
  • DIP: 29731
  • STRING: ENSP00000370989
• Other Databases: GeneCards:  CD274  Malacards:  CD274

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006955	immune response	IBA	biological process
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0042102	positive regulation of T cell proliferation	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0031295	T cell costimulation	IBA	biological process
GO:0042130	negative regulation of T cell proliferation	IBA	biological process
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0031901	early endosome membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0002845	positive regulation of tolerance induction to tumor cell	IMP	biological process
GO:0002845	positive regulation of tolerance induction to tumor cell	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:2001186	negative regulation of CD8-positive, alpha-beta T cell activation	IMP	biological process
GO:2001186	negative regulation of CD8-positive, alpha-beta T cell activation	IMP	biological process
GO:0005768	endosome	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0034097	response to cytokine	IDA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0031295	T cell costimulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:1901998	toxin transport	IEA	biological process
GO:0042130	negative regulation of T cell proliferation	IEA	biological process
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007165	signal transduction	IDA	biological process
GO:2001181	positive regulation of interleukin-10 secretion	IDA	biological process
GO:0007166	cell surface receptor signaling pathway	IDA	biological process
GO:0006955	immune response	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0031295	T cell costimulation	IDA	biological process
GO:1905404	positive regulation of activated CD8-positive, alpha-beta T cell apoptotic process	IDA	biological process
GO:1905399	regulation of activated CD4-positive, alpha-beta T cell apoptotic process	IDA	NOT|biological process
GO:2000562	negative regulation of CD4-positive, alpha-beta T cell proliferation	IDA	biological process
GO:0070232	regulation of T cell apoptotic process	IMP	NOT|biological process
GO:0032689	negative regulation of interferon-gamma production	IMP	biological process
GO:0032689	negative regulation of interferon-gamma production	IMP	biological process
GO:0032693	negative regulation of interleukin-10 production	IMP	biological process
GO:0046007	negative regulation of activated T cell proliferation	IMP	biological process
GO:0046006	regulation of activated T cell proliferation	IMP	NOT|biological process
GO:1903556	negative regulation of tumor necrosis factor superfamily cytokine production	IMP	biological process
GO:0032693	negative regulation of interleukin-10 production	IMP	biological process
GO:0042102	positive regulation of T cell proliferation	TAS	biological process
GO:0046006	regulation of activated T cell proliferation	IMP	NOT|biological process

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881