• Gene id: 29124

Gene Summary

• Gene Symbol: LGALS13   Gene   UCSC   Ensembl
• Aliases: GAL13, PLAC8, PP13
• Gene name: galectin 13
• Alternate names: galactoside-binding soluble lectin 13, beta-galactoside-binding lectin, gal-13, lectin, galactoside-binding, soluble, 13, placental protein 13, placental tissue protein 13,
• Gene location: 19q13.2 (39602410: 39607473)     Exons: 4     NC_000019.10
• Gene summary(Entrez): Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene has lysophospholipase activity. It is composed of two identical subunits which are held together by disulfi
• OMIM: 608717

Protein Summary

• Protein general information: Q9UHV8  
  • Name: Galactoside binding soluble lectin 13 (Galectin 13) (Gal 13) (Placental tissue protein 13) (PP13) (Placental protein 13)
  • Length: 139  
  • Mass: 16119
  • Tissue specificity: Detected in adult and fetal spleen, fetal kidney, adult urinary bladder and placenta. Placental expression originates predominantly from the syncytiotrophoblast. {ECO
• Sequence:

  MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLE
  ETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN

• Structural information:
  • Protein Domains: (6..13-)
    (/note="Galectin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00639"-)
  • Interpro: IPR013320  IPR030653  IPR001079  
  • Prosite: PS51304
  • CDD: cd00070
  • PDB: 1F87 5XG7 5XG8 5Y03 6A62 6A63 6A64 6A65 6A66 6KJW 6KJX 6KJY
  • PDBsum: 1F87 5XG7 5XG8 5Y03 6A62 6A63 6A64 6A65 6A66 6KJW 6KJX 6KJY
  • STRING: ENSP00000221797
• Other Databases: GeneCards:  LGALS13  Malacards:  LGALS13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016363	nuclear matrix	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0004622	lysophospholipase activity	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0070234	positive regulation of T cell apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004622	lysophospholipase activity	TAS	molecular function
GO:0006644	phospholipid metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016363	nuclear matrix	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq