Search Result
Gene id | 29121 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Symbol | CLEC2D Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Aliases | CLAX, LLT1, OCIL | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene name | C-type lectin domain family 2 member D | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Alternate names | C-type lectin domain family 2 member D, C-type lectin related f, C-type lectin superfamily 2, member D, LLT-1, lectin-like NK cell receptor, lectin-like transcript 1, osteoclast inhibitory lectin, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene location |
12p13.31 (7751599: 7729244) Exons: 8 NC_000012.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
OMIM | 605659 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein general information | Q9UHP7 Name: C type lectin domain family 2 member D (Lectin like NK cell receptor) (Lectin like transcript 1) (LLT 1) (Osteoclast inhibitory lectin) Length: 191 Mass: 21849 Tissue specificity: Detected in peripheral blood leukocytes, osteoblasts, lymph node, thymus and spleen. Isoform 1, isoform 2 and isoform 4 are expressed in T- and B-lymphocytes, and at lower levels in NK cells. They are also expressed in B-cell lines and | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequence |
MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAAC PESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTE WTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: CLEC2D  Malacards: CLEC2D | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|