• Gene id: 29118

Gene Summary

• Gene Symbol: DDX25   Gene   UCSC   Ensembl
• Aliases: GRTH
• Gene name: DEAD-box helicase 25
• Alternate names: ATP-dependent RNA helicase DDX25, DEAD (Asp-Glu-Ala-Asp) box helicase 25, DEAD (Asp-Glu-Ala-Asp) box polypeptide 25, DEAD box protein 25, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 25, gonadotropin-regulated testicular RNA helicase,
• Gene location: 11q24.2 (125903375: 125923403)     Exons: 14     NC_000011.10
• Gene summary(Entrez): DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and
• OMIM: 607663

Protein Summary

• Protein general information: Q9UHL0  
  • Name: ATP dependent RNA helicase DDX25 (EC 3.6.4.13) (DEAD box protein 25) (Gonadotropin regulated testicular RNA helicase)
  • Length: 483  
  • Mass: 54,692
• Sequence:

  MASLLWGGDAGAAESERLNSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVDLAANSLLNKLIHQSL
  VESSHRVEVLQKDPSSPLYSVKTFEELRLKEELLKGIYAMGFNRPSKIQEMALPMMLAHPPQNLIAQSQSGTGKT
  AAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMGKFCVDVQVMYAIRGNRIPRGTDITKQIIIGTPGT
  VLDWCFKLKLIDLTKIRVFVLDEADVMIDTQGFSDHSIRIQRALPSECQMLLFSATFEDSVWHFAERIIPDPNVI
  KLRKEELTLNNIRQYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRNAKWLTVEMIQDGHQVSLLSGELTVE
  QRASIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVKQGEEPDYETYLHRIGRTGRFGKKGLAFNMIEV
  DELPSLMKIQDHFNSSIKQLNAEDMDEIEKIDY

• Structural information:
  • Protein Domains: Helicase (130-300)
    Helicase (311-478)
  • Interpro: IPR011545  IPR014001  IPR001650  IPR027417  IPR014014  
  • Prosite: PS51192 PS51194 PS51195
  • CDD: cd00079
  • PDB: 2RB4
  • PDBsum: 2RB4
  • STRING: ENSP00000263576
• Other Databases: GeneCards:  DDX25  Malacards:  DDX25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IEA	molecular function
GO:0004004	ATP-dependent RNA helicase activity	ISS	molecular function
GO:0004004	ATP-dependent RNA helicase activity	IBA	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0006406	mRNA export from nucleus	ISS	biological process
GO:0006406	mRNA export from nucleus	IBA	biological process
GO:0006417	regulation of translation	ISS	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007286	spermatid development	ISS	biological process
GO:0010501	RNA secondary structure unwinding	IBA	biological process
GO:0033391	chromatoid body	ISS	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0004004	ATP-dependent RNA helicase activity	IEA	molecular function
GO:0004004	ATP-dependent RNA helicase activity	ISS	molecular function
GO:0004004	ATP-dependent RNA helicase activity	IBA	molecular function
GO:0004386	helicase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006406	mRNA export from nucleus	IEA	biological process
GO:0006406	mRNA export from nucleus	ISS	biological process
GO:0006406	mRNA export from nucleus	IBA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0006417	regulation of translation	ISS	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0006810	transport	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007286	spermatid development	IEA	biological process
GO:0007286	spermatid development	ISS	biological process
GO:0010501	RNA secondary structure unwinding	IBA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0033391	chromatoid body	IEA	cellular component
GO:0033391	chromatoid body	ISS	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0004004	ATP-dependent RNA helicase activity	ISS	molecular function
GO:0004004	ATP-dependent RNA helicase activity	IBA	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0006406	mRNA export from nucleus	ISS	biological process
GO:0006406	mRNA export from nucleus	IBA	biological process
GO:0006417	regulation of translation	ISS	biological process
GO:0007286	spermatid development	ISS	biological process
GO:0010501	RNA secondary structure unwinding	IBA	biological process
GO:0033391	chromatoid body	ISS	cellular component

Diseases

Associated diseases	References
Cancer (colorectal)	GAD: 19536092
Cancer	GAD: 19536092
Oligozoospermia	GAD: 16293649
Male factor infertility	MIK: 17848414
Male factor infertility	MIK: 17848414
Spermatogenesis defects	MIK: 16293649
Azoospermia	MIK: 17848414
Azoospermia	MIK: 17848414
Azoospermia	MIK: 17848414
Male infertility	MIK: 17848414
Essential regulator for sperm maturation	MIK: 16968703
Hypospermatogenesis	MIK: 28361989
Non obstructive azoospermia	MIK: 23869807
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17848414	Azoospermia, male infertility	R242H in exon 8, silent mutation in exon11	Japanes e	243 (143 NOA, 100 fertile Japanese men)	Male infertility	GRTH DDX25
16968703	Essential regulator for sperm maturation				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray