• Gene id: 2911

Gene Summary

• Gene Symbol: GRM1   Gene   UCSC   Ensembl
• Aliases: GPRC1A, MGLU1, MGLUR1, PPP1R85, SCA44, SCAR13
• Gene name: glutamate metabotropic receptor 1
• Alternate names: metabotropic glutamate receptor 1, glutamate receptor, metabotropic 1, protein phosphatase 1, regulatory subunit 85,
• Gene location: 6q24.3 (146027633: 146437600)     Exons: 11     NC_000006.12
• Gene summary(Entrez): This gene encodes a metabotropic glutamate receptor that functions by activating phospholipase C. L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutam
• OMIM: 191275

Protein Summary

• Protein general information: Q13255  
  • Name: Metabotropic glutamate receptor 1 (mGluR1)
  • Length: 1194  
  • Mass: 132357
  • Tissue specificity: Detected in brain.
• Sequence:

  MVGLLLFFFPAIFLEVSLLPRSPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYG
  IQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGINRCLPDGQSLPPG
  RTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWT
  YVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
  SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHR
  FQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKL
  LDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGVVRSVCS
  EPCLKGQIKVIRKGEVSCCWICTACKENEYVQDEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFS
  CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSAL
  VTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSN
  LGVVAPLGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTV
  ALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKAGAGNANSNGKSVSWSEPGG
  GQVPKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEEEDAQPIRFSPPGSPS
  MVVHRRVPSAATTPPLPSHLTAEETPLFLAEPALPKGLPPPLQQQQQPPPQQKSLMDQLQGVVSNFSTAIPDFHA
  VLAGPGGPGNGLRSLYPPPPPPQHLQMLPLQLSTFGEELVSPPADDDDDSERFKLLQEYVYEHEREGNTEEDELE
  EEEEDLQAASKLTPDDSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVSYASVILRDYKQSSSTL

• Structural information:
  • Interpro: IPR001828  IPR000337  IPR011500  IPR038550  IPR017978   IPR017979  IPR000162  IPR001256  IPR019588  IPR028082  
  • Prosite: PS00979 PS00980 PS00981 PS50259
  • PDB: 3KS9 4OR2
  • PDBsum: 3KS9 4OR2
  • DIP: 57522
  • STRING: ENSP00000354896
• Other Databases: GeneCards:  GRM1  Malacards:  GRM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098839	postsynaptic density membrane	IBA	cellular component
GO:0099583	neurotransmitter receptor activity involved in regulation of postsynaptic cytosolic calcium ion concentration	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007216	G protein-coupled glutamate receptor signaling pathway	IBA	biological process
GO:0008066	glutamate receptor activity	IBA	molecular function
GO:0051966	regulation of synaptic transmission, glutamatergic	IBA	biological process
GO:0099530	G protein-coupled receptor activity involved in regulation of postsynaptic membrane potential	IBA	molecular function
GO:0038037	G protein-coupled receptor dimeric complex	IDA	cellular component
GO:0008066	glutamate receptor activity	IDA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0007216	G protein-coupled glutamate receptor signaling pathway	IMP	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IMP	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IMP	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0008066	glutamate receptor activity	IDA	molecular function
GO:0038038	G protein-coupled receptor homodimeric complex	IPI	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0099583	neurotransmitter receptor activity involved in regulation of postsynaptic cytosolic calcium ion concentration	IEA	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0043408	regulation of MAPK cascade	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0007626	locomotory behavior	IEA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0098872	G protein-coupled neurotransmitter receptor activity involved in regulation of postsynaptic cytosolic calcium ion concentration	IEA	molecular function
GO:0071257	cellular response to electrical stimulus	IEA	biological process
GO:0051930	regulation of sensory perception of pain	IEA	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0099566	regulation of postsynaptic cytosolic calcium ion concentration	IEA	biological process
GO:0099566	regulation of postsynaptic cytosolic calcium ion concentration	IEA	biological process
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process
GO:0008066	glutamate receptor activity	TAS	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway
hsa04723	Retrograde endocannabinoid signaling
hsa05017	Spinocerebellar ataxia
hsa04072	Phospholipase D signaling pathway
hsa04724	Glutamatergic synapse
hsa04068	FoxO signaling pathway
hsa04915	Estrogen signaling pathway
hsa04540	Gap junction
hsa04742	Taste transduction
hsa04720	Long-term potentiation
hsa04730	Long-term depression

Diseases

Associated diseases	References
Spinocerebellar ataxia	KEGG:H00063
Autosomal recessive spinocerebellar ataxias	KEGG:H01891
Spinocerebellar ataxia	KEGG:H00063
Autosomal recessive spinocerebellar ataxias	KEGG:H01891
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R