• Gene id: 29107

Gene Summary

• Gene Symbol: NXT1   Gene   UCSC   Ensembl
• Aliases: MTR2, P15
• Gene name: nuclear transport factor 2 like export factor 1
• Alternate names: NTF2-related export protein 1, NTF2-like export factor 1, NTX2-like export factor1, NUTF-like export factor 1, protein p15,
• Gene location: 20p11.21 (23350790: 23354770)     Exons: 7     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is located in the nuclear envelope. It has protein similarity to nuclear transport factor 2. This protein functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome re
• OMIM: 605811

Protein Summary

• Protein general information: Q9UKK6  
  • Name: NTF2 related export protein 1 (Protein p15)
  • Length: 140  
  • Mass: 15847
• Sequence:

  MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVV
  DCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS

• Structural information:
  • Protein Domains: (16..13-)
    (/note="NTF2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00137"-)
  • Interpro: IPR002075  IPR032710  IPR018222  
  • Prosite: PS50177
  • CDD: cd00780
  • PDB: 1JKG 1JN5 4WYK 6E5U
  • PDBsum: 1JKG 1JN5 4WYK 6E5U
  • DIP: 33075
  • STRING: ENSP00000254998
• Other Databases: GeneCards:  NXT1  Malacards:  NXT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0044613	nuclear pore central transport channel	IBA	cellular component
GO:0006913	nucleocytoplasmic transport	IBA	biological process
GO:0006606	protein import into nucleus	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005643	nuclear pore	TAS	cellular component
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005643	nuclear pore	IEA	cellular component
GO:0006405	RNA export from nucleus	IEA	biological process
GO:0006611	protein export from nucleus	IEA	biological process
GO:0008536	Ran GTPase binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa05164	Influenza A
hsa03015	mRNA surveillance pathway
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq