• Gene id: 29105

Gene Summary

• Gene Symbol: CFAP20   Gene   UCSC   Ensembl
• Aliases: BUG22, C16orf80, EVORF, GTL3, fSAP23
• Gene name: cilia and flagella associated protein 20
• Alternate names: cilia- and flagella-associated protein 20, UPF0468 protein C16orf80, basal body up-regulated protein 22, flagellar associated protein 20 homolog, functional spliceosome-associated protein 23, gene trap locus 3, transcription factor IIB,
• Gene location: 16q21 (58129424: 58113587)     Exons: 6     NC_000016.10
• OMIM: 611401

Protein Summary

• Protein general information: Q9Y6A4  
  • Name: Cilia and flagella associated protein 20 (Basal body up regulated protein 22) (Transcription factor IIB)
  • Length: 193  
  • Mass: 22774
• Sequence:

  MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPF
  LVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIE
  TLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

• Structural information:
  • Interpro: IPR040441  IPR007714  
  • STRING: ENSP00000262498
• Other Databases: GeneCards:  CFAP20  Malacards:  CFAP20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000147	positive regulation of cell motility	IBA	biological process
GO:0060296	regulation of cilium beat frequency involved in ciliary motility	IBA	biological process
GO:0060271	cilium assembly	IBA	biological process
GO:0036064	ciliary basal body	IBA	cellular component
GO:0031514	motile cilium	IBA	cellular component
GO:0005929	cilium	IBA	cellular component
GO:2000253	positive regulation of feeding behavior	IDA	biological process
GO:0005929	cilium	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:2000147	positive regulation of cell motility	IDA	biological process
GO:0060296	regulation of cilium beat frequency involved in ciliary motility	IDA	biological process
GO:0036064	ciliary basal body	IDA	cellular component
GO:0018095	protein polyglutamylation	IMP	biological process
GO:0060271	cilium assembly	IMP	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005929	cilium	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881