• Gene id: 29103

Gene Summary

• Gene Symbol: DNAJC15   Gene   UCSC   Ensembl
• Aliases: DNAJD1, HSD18, MCJ
• Gene name: DnaJ heat shock protein family (Hsp40) member C15
• Alternate names: dnaJ homolog subfamily C member 15, DNAJ domain-containing, DnaJ (Hsp40) homolog, subfamily C, member 15, DnaJ (Hsp40) homolog, subfamily D, member 1, cell growth-inhibiting gene 22 protein, methylation-controlled J protein,
• Gene location: 13q14.11 (43023585: 43114212)     Exons: 6     NC_000013.11
• OMIM: 615339

Protein Summary

• Protein general information: Q9Y5T4  
  • Name: DnaJ homolog subfamily C member 15 (Cell growth inhibiting gene 22 protein) (Methylation controlled J protein) (MCJ)
  • Length: 150  
  • Mass: 16383
  • Tissue specificity: Expressed at highest levels in heart, followed by liver and kidney. {ECO
• Sequence:

  MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKI
  STPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH

• Structural information:
  • Protein Domains: (96..15-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286"-)
  • Interpro: IPR001623  IPR036869  
  • Prosite: PS50076
  • CDD: cd06257
  • STRING: ENSP00000368523
• Other Databases: GeneCards:  DNAJC15  Malacards:  DNAJC15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001671	ATPase activator activity	IBA	molecular function
GO:0001405	PAM complex, Tim23 associated import motor	IBA	cellular component
GO:0030150	protein import into mitochondrial matrix	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902957	negative regulation of mitochondrial electron transport, NADH to ubiquinone	IEA	biological process
GO:0009267	cellular response to starvation	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0031333	negative regulation of protein-containing complex assembly	IEA	biological process
GO:0019216	regulation of lipid metabolic process	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0032781	positive regulation of ATPase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R