About Us

Search Result


Gene id 291
Gene Summary     SNPs    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol SLC25A4   Gene   UCSC   Ensembl
Aliases AAC1, ANT, ANT 1, ANT1, MTDPS12, MTDPS12A, PEO2, PEO3, PEOA2, T1
Gene name solute carrier family 25 member 4
Alternate names ADP/ATP translocase 1, ADP,ATP carrier protein 1, ADP,ATP carrier protein, heart/skeletal muscle, adenine nucleotide translocator 1 (skeletal muscle), heart/skeletal muscle ATP/ADP translocator, solute carrier family 25 (mitochondrial carrier; adenine nucleoti,
Gene location 4q35.1 (185143265: 185150381)     Exons: 4     NC_000004.12
Gene summary(Entrez) This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix i
OMIM 103220

SNPs


rs642321

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.31400896T>A
NC_000005.10   g.31400896T>C
NC_000005.9   g.31401003T>A
NC_000005.9   g.31401003T>C
NG_051574.1   g.136280A>T
NG_051574.1   g.136280A>G
NM_013235.5   c.*536A>T
NM_013235.5   c.*536A>G
NM_013235.4   c.*536A>T
NM_013235.4   c.*536A>G
NM_00110  

rs10719

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.31401340A>G
NC_000005.10   g.31401340A>T
NC_000005.9   g.31401447A>G
NC_000005.9   g.31401447A>T
NG_051574.1   g.135836T>C
NG_051574.1   g.135836T>A
NM_013235.5   c.*92T>C
NM_013235.5   c.*92T>A
NM_013235.4   c.*92T>C
NM_013235.4   c.*92T>A
NM_001100412  

rs700519

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000015.10   g.51215771G>A
NC_000015.9   g.51507968G>A
NG_007982.1   g.127828C>T
NM_000103.4   c.790C>T
NM_000103.3   c.790C>T
NM_031226.3   c.790C>T
NM_031226.2   c.790C>T
NM_001347255.2   c.790C>T
NM_001347255.1   c.790C>T
NM_001347256.2   c.790C>T
NM_001347256.1   c.

rs2656927

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.4908263C>T
NC_000019.9   g.4908275C>T
NG_033256.2   g.10184C>T|SEQ=[C/T]|GENE=UHRF1
ARRDC5   645432

rs8103849

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.4909617C>G
NC_000019.9   g.4909629C>G
NG_033256.2   g.11538C>G
NM_001048201.3   c.-49C>G
NM_001048201.2   c.-49C>G
NM_001048201.1   c.-49C>G
XM_011527942.2   c.-49C>G|SEQ=[C/G]|GENE=UHRF1
ARRDC5   645432

rs498422

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.32318984T>G
NC_000006.11   g.32286761T>G
NT_113891.3   g.3757457T>G
NT_113891.2   g.3757563T>G
NT_167248.2   g.3542362G>T
NT_167248.1   g.3547958G>T
NT_167245.2   g.3560446T>G
NT_167245.1   g.3566031T>G
NT_167249.2   g.3635248T>G
NT_167249.1   g.3634546

rs2291109

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.31532322A>G
NC_000005.10   g.31532322A>T
NC_000005.9   g.31532429A>G
NC_000005.9   g.31532429A>T
NG_051574.1   g.4854T>C
NG_051574.1   g.4854T>A
NM_018356.3   c.-71A>G
NM_018356.3   c.-71A>T
NM_018356.2   c.-71A>G
NM_018356.2   c.-71A>T
XM_011514062.3   c

rs17409893

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.31532682A>G
NC_000005.9   g.31532789A>G
NG_051574.1   g.4494T>C|SEQ=[A/G]|GENE=DROSHA
C5orf22   55322

Protein Summary

Protein general information P12235  

Name: ADP/ATP translocase 1 (ADP,ATP carrier protein 1) (ADP,ATP carrier protein, heart/skeletal muscle isoform T1) (Adenine nucleotide translocator 1) (ANT 1) (Solute carrier family 25 member 4)

Length: 298  Mass: 33064

Sequence MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNL
ANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAA
QREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAG
LVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
Structural information
Interpro:  IPR002113  IPR002067  IPR018108  IPR023395  
Prosite:   PS50920

DIP:  

33116

MINT:  
STRING:   ENSP00000281456
Other Databases GeneCards:  SLC25A4  Malacards:  SLC25A4

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005471 ATP:ADP antiporter activi
ty
IBA molecular function
GO:0015866 ADP transport
IMP biological process
GO:0032592 integral component of mit
ochondrial membrane
ISS cellular component
GO:0005347 ATP transmembrane transpo
rter activity
IEA molecular function
GO:0022857 transmembrane transporter
activity
IEA molecular function
GO:0005743 mitochondrial inner membr
ane
IEA cellular component
GO:0055085 transmembrane transport
IEA biological process
GO:0005739 mitochondrion
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0016032 viral process
IEA biological process
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0005743 mitochondrial inner membr
ane
IEA cellular component
GO:0015207 adenine transmembrane tra
nsporter activity
TAS molecular function
GO:0000002 mitochondrial genome main
tenance
TAS biological process
GO:0005739 mitochondrion
TAS cellular component
GO:0005887 integral component of pla
sma membrane
TAS cellular component
GO:0006091 generation of precursor m
etabolites and energy
TAS biological process
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0050796 regulation of insulin sec
retion
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0008637 apoptotic mitochondrial c
hanges
IEA biological process
GO:0005515 protein binding
IPI molecular function
GO:0060546 negative regulation of ne
croptotic process
IMP biological process
GO:0005743 mitochondrial inner membr
ane
IEA cellular component
GO:0005739 mitochondrion
IDA cellular component
GO:0015853 adenine transport
IEA biological process
GO:0015867 ATP transport
IEA biological process
GO:0015867 ATP transport
IEA biological process
GO:0005739 mitochondrion
HDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05010Alzheimer disease
hsa05016Huntington disease
hsa05012Parkinson disease
hsa05166Human T-cell leukemia virus 1 infection
hsa04020Calcium signaling pathway
hsa04022cGMP-PKG signaling pathway
hsa04217Necroptosis
hsa05164Influenza A
hsa04218Cellular senescence
Associated diseases References
Mitochondrial DNA depletion syndrome KEGG:H00469
Progressive external ophthalmoplegia KEGG:H01118
Mitochondrial DNA depletion syndrome KEGG:H00469
Progressive external ophthalmoplegia KEGG:H01118
Dilated cardiomyopathy 1H PMID:12056860
Alzheimer's disease PMID:21958963
facioscapulohumeral muscular dystrophy PMID:15551024
hypertrophic cardiomyopathy PMID:16155110
chronic progressive external ophthalmoplegia PMID:12565915
chronic progressive external ophthalmoplegia PMID:15792871
mitochondrial myopathy PMID:16155110
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
31037746 Spermatoge
nic defect
s

28 men with az
oospermia
Male infertility Microarray
Show abstract