About Us

Search Result


Gene id 29093
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol MRPL22   Gene   UCSC   Ensembl
Aliases HSPC158, L22mt, MRP-L22, MRP-L25, RPML25
Gene name mitochondrial ribosomal protein L22
Alternate names 39S ribosomal protein L22, mitochondrial, 39S ribosomal protein L25, mitochondrial, L25mt, mitochondrial large ribosomal subunit protein uL22m,
Gene location 5q33.2 (154941072: 154969410)     Exons: 7     NC_000005.10
Gene summary(Entrez) Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
OMIM 611835

Protein Summary

Protein general information Q9NWU5  

Name: 39S ribosomal protein L22, mitochondrial (L22mt) (MRP L22) (39S ribosomal protein L25, mitochondrial) (L25mt) (MRP L25) (Mitochondrial large ribosomal subunit protein uL22m)

Length: 206  Mass: 23641

Sequence MAAAVLGQLGALWIHNLRSRGKLALGVLPQSYIHTSASLDISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIK
YSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRI
RYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTL
Structural information
Interpro:  IPR001063  IPR036394  IPR005727  
CDD:   cd00336

PDB:  
3J7Y 5OOL 5OOM 6NU2 6NU3
PDBsum:   3J7Y 5OOL 5OOM 6NU2 6NU3
MINT:  
STRING:   ENSP00000431040
Other Databases GeneCards:  MRPL22  Malacards:  MRPL22

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0003735 structural constituent of
ribosome
IBA molecular function
GO:0005762 mitochondrial large ribos
omal subunit
IBA cellular component
GO:0015934 large ribosomal subunit
IBA cellular component
GO:0042255 ribosome assembly
IBA biological process
GO:0005762 mitochondrial large ribos
omal subunit
IDA cellular component
GO:0005762 mitochondrial large ribos
omal subunit
IDA cellular component
GO:0005739 mitochondrion
IDA cellular component
GO:0005840 ribosome
IEA cellular component
GO:0006412 translation
IEA biological process
GO:0003735 structural constituent of
ribosome
IEA molecular function
GO:0015934 large ribosomal subunit
IEA cellular component
GO:0005840 ribosome
IEA cellular component
GO:0005739 mitochondrion
IEA cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0070125 mitochondrial translation
al elongation
TAS biological process
GO:0070126 mitochondrial translation
al termination
TAS biological process
GO:0005739 mitochondrion
IEA cellular component
GO:0003723 RNA binding
HDA molecular function
GO:0005739 mitochondrion
ISS cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03010Ribosome
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract