• Gene id: 29093

Gene Summary

• Gene Symbol: MRPL22   Gene   UCSC   Ensembl
• Aliases: HSPC158, L22mt, MRP-L22, MRP-L25, RPML25
• Gene name: mitochondrial ribosomal protein L22
• Alternate names: 39S ribosomal protein L22, mitochondrial, 39S ribosomal protein L25, mitochondrial, L25mt, mitochondrial large ribosomal subunit protein uL22m,
• Gene location: 5q33.2 (154941072: 154969410)     Exons: 7     NC_000005.10
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611835

Protein Summary

• Protein general information: Q9NWU5  
  • Name: 39S ribosomal protein L22, mitochondrial (L22mt) (MRP L22) (39S ribosomal protein L25, mitochondrial) (L25mt) (MRP L25) (Mitochondrial large ribosomal subunit protein uL22m)
  • Length: 206  
  • Mass: 23641
• Sequence:

  MAAAVLGQLGALWIHNLRSRGKLALGVLPQSYIHTSASLDISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIK
  YSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRI
  RYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTL

• Structural information:
  • Interpro: IPR001063  IPR036394  IPR005727  
  • CDD: cd00336
  • PDB: 3J7Y 5OOL 5OOM 6NU2 6NU3
  • PDBsum: 3J7Y 5OOL 5OOM 6NU2 6NU3
  • STRING: ENSP00000431040
• Other Databases: GeneCards:  MRPL22  Malacards:  MRPL22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005762	mitochondrial large ribosomal subunit	IBA	cellular component
GO:0015934	large ribosomal subunit	IBA	cellular component
GO:0042255	ribosome assembly	IBA	biological process
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0015934	large ribosomal subunit	IEA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005739	mitochondrion	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)