• Gene id: 29090

Gene Summary

• Gene Symbol: TIMM21   Gene   UCSC   Ensembl
• Aliases: C18orf55, HSPC154, TIM21
• Gene name: translocase of inner mitochondrial membrane 21
• Alternate names: mitochondrial import inner membrane translocase subunit Tim21, TIM21-like protein, mitochondrial, translocase of inner mitochondrial membrane 21 homolog,
• Gene location: 18q22.3 (74148516: 74160530)     Exons: 6     NC_000018.10
• OMIM: 615180

Protein Summary

• Protein general information: Q9BVV7  
  • Name: Mitochondrial import inner membrane translocase subunit Tim21 (TIM21 like protein, mitochondrial)
  • Length: 248  
  • Mass: 28202
• Sequence:

  MICTFLRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKA
  KEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISITGGLFYTIFKELFSSSSPSKIYGRALEKCR
  SHPEVIGVFGESVKGYGEVTRRGRRQHVRFTEYVKDGLKHTCVKFYIEGSEPGKQGTVYAQVKENPGSGEYDFRY
  IFVEIESYPRRTIIIEDNRSQDD

• Structural information:
  • Interpro: IPR013261  IPR038552  
  • STRING: ENSP00000169551
• Other Databases: GeneCards:  TIMM21  Malacards:  TIMM21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030150	protein import into mitochondrial matrix	IBA	biological process
GO:0005744	TIM23 mitochondrial import inner membrane translocase complex	IBA	cellular component
GO:0005744	TIM23 mitochondrial import inner membrane translocase complex	IDA	cellular component
GO:0030150	protein import into mitochondrial matrix	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0033617	mitochondrial cytochrome c oxidase assembly	IMP	biological process
GO:0032981	mitochondrial respiratory chain complex I assembly	IMP	biological process
GO:0005744	TIM23 mitochondrial import inner membrane translocase complex	IEA	cellular component
GO:0030150	protein import into mitochondrial matrix	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003674	molecular_function	ND	molecular function
GO:0031966	mitochondrial membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)