• Gene id: 29087

Gene Summary

• Gene Symbol: THYN1   Gene   UCSC   Ensembl
• Aliases: HSPC144, MDS012, MY105, THY28, THY28KD
• Gene name: thymocyte nuclear protein 1
• Alternate names: thymocyte nuclear protein 1, thymocyte protein thy28,
• Gene location: 11q25 (134253351: 134248281)     Exons: 8     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul
• OMIM: 609956

Protein Summary

• Protein general information: Q9P016  
  • Name: Thymocyte nuclear protein 1 (Thymocyte protein Thy28)
  • Length: 225  
  • Mass: 25697
• Sequence:

  MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKF
  SIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPS
  SKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEEKEPS

• Structural information:
  • Interpro: IPR002740  IPR015947  
  • PDB: 3EOP 5J3E
  • PDBsum: 3EOP 5J3E
  • STRING: ENSP00000341657
• Other Databases: GeneCards:  THYN1  Malacards:  THYN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq