• Gene id: 29085

Gene Summary

• Gene Symbol: PHPT1   Gene   UCSC   Ensembl
• Aliases: CGI-202, HEL-S-132P, HSPC141, PHP, PHP14
• Gene name: phosphohistidine phosphatase 1
• Alternate names: 14 kDa phosphohistidine phosphatase, epididymis secretory sperm binding protein Li 132P, protein histidine phosphatase, protein janus-A homolog, sex-regulated protein janus-a,
• Gene location: 9q34.3 (124450034: 124445242)     Exons: 2     NC_000010.11
• Gene summary(Entrez): This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation
• OMIM: 610167

Protein Summary

• Protein general information: Q9NRX4  
  • Name: 14 kDa phosphohistidine phosphatase (EC 3.9.1.3) (Phosphohistidine phosphatase 1) (PHPT1) (Protein histidine phosphatase) (PHP) (Protein janus A homolog)
  • Length: 125  
  • Mass: 13833
  • Tissue specificity: Expressed abundantly in heart and skeletal muscle. {ECO
• Sequence:

  MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLG
  GGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

• Structural information:
  • Interpro: IPR007702  IPR038596  IPR028441  
  • PDB: 2AI6 2HW4 2NMM 2OZW 2OZX
  • PDBsum: 2AI6 2HW4 2NMM 2OZW 2OZX
  • DIP: 48597
  • STRING: ENSP00000247665
• Other Databases: GeneCards:  PHPT1  Malacards:  PHPT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0035971	peptidyl-histidine dephosphorylation	IBA	biological process
GO:0101006	protein histidine phosphatase activity	IBA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0035971	peptidyl-histidine dephosphorylation	IEA	biological process
GO:0101006	protein histidine phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:2000147	positive regulation of cell motility	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0101006	protein histidine phosphatase activity	IEA	molecular function
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0051350	negative regulation of lyase activity	IEA	biological process
GO:0101006	protein histidine phosphatase activity	IDA	molecular function
GO:0101006	protein histidine phosphatase activity	IDA	molecular function
GO:0101006	protein histidine phosphatase activity	IDA	molecular function
GO:0019855	calcium channel inhibitor activity	IDA	molecular function
GO:0101006	protein histidine phosphatase activity	IMP	molecular function
GO:0044325	ion channel binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0035971	peptidyl-histidine dephosphorylation	IDA	biological process
GO:0035971	peptidyl-histidine dephosphorylation	IDA	biological process
GO:2000147	positive regulation of cell motility	IMP	biological process
GO:0051350	negative regulation of lyase activity	IDA	biological process
GO:0051350	negative regulation of lyase activity	IDA	biological process
GO:2000984	negative regulation of ATP citrate synthase activity	IDA	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IMP	biological process
GO:2000249	regulation of actin cytoskeleton reorganization	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Low sperm motility	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Low sperm motility			18	Male infertility	GSE26881
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881