• Gene id: 29081

Gene Summary

• Gene Symbol: METTL5   Gene   UCSC   Ensembl
• Aliases: HSPC133, MRT72
• Gene name: methyltransferase like 5
• Alternate names: rRNA N6-adenosine-methyltransferase METTL5, methyltransferase-like protein 5,
• Gene location: 2q31.1 (169824930: 169811756)     Exons: 8     NC_000002.12
• OMIM: 618628

Protein Summary

• Protein general information: Q9NRN9  
  • Name: rRNA N6 adenosine methyltransferase METTL5 (EC 2.1.1. ) (Methyltransferase like protein 5)
  • Length: 209  
  • Mass: 23719
  • Tissue specificity: Expressed from very early development (8 post-conceptual weeks) and expression persists through adulthood in multiple substructures of the brain, including the cerebellar cortex, hippocampus, and striatum. {ECO
• Sequence:

  MKKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAG
  LCVGFDIDEDALEIFNRNAEEFELTNIDMVQCDVCLLSNRMSKSFDTVIMNPPFGTKNNKGTDMAFLKTALEMAR
  TAVYSLHKSSTREHVQKKAAEWKIKIDIIAELRYDLPASYKFHKKKSVDIEVDLIRFSF

• Structural information:
  • Interpro: IPR002052  IPR029063  IPR007848  
  • Prosite: PS00092
  • PDB: 6H2U 6H2V
  • PDBsum: 6H2U 6H2V
  • STRING: ENSP00000260953
• Other Databases: GeneCards:  METTL5  Malacards:  METTL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098794	postsynapse	IDA	cellular component
GO:1904047	S-adenosyl-L-methionine binding	IDA	molecular function
GO:0008988	rRNA (adenine-N6-)-methyltransferase activity	IDA	molecular function
GO:0098793	presynapse	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0031167	rRNA methylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032259	methylation	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098794	postsynapse	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq