• Gene id: 2901

Gene Summary

• Gene Symbol: GRIK5   Gene   UCSC   Ensembl
• Aliases: EAA2, GRIK2, GluK5, KA2
• Gene name: glutamate ionotropic receptor kainate type subunit 5
• Alternate names: glutamate receptor ionotropic, kainate 5, excitatory amino acid receptor 2, glutamate receptor KA2,
• Gene location: 19q13.2 (42071803: 41998315)     Exons: 26     NC_000019.10
• Gene summary(Entrez): This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane
• OMIM: 609778

Protein Summary

• Protein general information: Q16478  
  • Name: Glutamate receptor ionotropic, kainate 5 (GluK5) (Excitatory amino acid receptor 2) (EAA2) (Glutamate receptor KA 2) (KA2)
  • Length: 980  
  • Mass: 109265
• Sequence:

  MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAKARVEVDIFELQRDSQ
  YETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKVGPEETPRLQYLRFASVSLYPSNEDVSLAVS
  RILKSFNYPSASLICAKAECLLRLEELVRGFLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHL
  ILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYLGP
  ALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTGRVEFNSKGQRTNYTL
  RILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVTTILENPYVMRRPNFQALSGNERFEGFCVDM
  LRELAELLRFRYRLRLVEDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILY
  RVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPV
  GGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTM
  TFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQIGGLLDTKGYGI
  GMPLGSPFRDEITLAILQLQENNRLEILKRKWWEGGRCPKEEDHRAKGLGMENIGGIFIVLICGLIIAVFVAVME
  FIWSTRRSAESEEVSVCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAG
  SAHGGPQRLLDDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEATSPPRPRPGPAGPRE
  LAEHE

• Structural information:
  • Interpro: IPR001828  IPR019594  IPR001508  IPR001320  IPR028082  
  • STRING: ENSP00000262895
• Other Databases: GeneCards:  GRIK5  Malacards:  GRIK5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015276	ligand-gated ion channel activity	IBA	molecular function
GO:0015277	kainate selective glutamate receptor activity	IBA	molecular function
GO:0035249	synaptic transmission, glutamatergic	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0042734	presynaptic membrane	IBA	cellular component
GO:0098839	postsynaptic density membrane	IBA	cellular component
GO:1904315	transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0008066	glutamate receptor activity	IBA	molecular function
GO:0032983	kainate selective glutamate receptor complex	IBA	cellular component
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0050804	modulation of chemical synaptic transmission	IBA	biological process
GO:0004970	ionotropic glutamate receptor activity	IEA	molecular function
GO:0015276	ligand-gated ion channel activity	IEA	molecular function
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:1904315	transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential	IEA	molecular function
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0035249	synaptic transmission, glutamatergic	IEA	biological process
GO:0031630	regulation of synaptic vesicle fusion to presynaptic active zone membrane	IEA	biological process
GO:0015277	kainate selective glutamate receptor activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0051649	establishment of localization in cell	IEA	biological process
GO:0043195	terminal bouton	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0015277	kainate selective glutamate receptor activity	IEA	molecular function
GO:0008328	ionotropic glutamate receptor complex	IEA	cellular component
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0042391	regulation of membrane potential	IEA	biological process
GO:0032983	kainate selective glutamate receptor complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0043113	receptor clustering	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0030165	PDZ domain binding	IEA	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0008066	glutamate receptor activity	IEA	molecular function
GO:0006621	protein retention in ER lumen	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0035235	ionotropic glutamate receptor signaling pathway	IEA	biological process
GO:0035235	ionotropic glutamate receptor signaling pathway	IEA	biological process
GO:0035235	ionotropic glutamate receptor signaling pathway	IEA	biological process
GO:0035235	ionotropic glutamate receptor signaling pathway	IEA	biological process
GO:0035235	ionotropic glutamate receptor signaling pathway	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0015277	kainate selective glutamate receptor activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04724	Glutamatergic synapse

Diseases

Associated diseases	References
Temporal lobe epilepsy	PMID:9848088
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq