• Gene id: 28996

Gene Summary

• Gene Symbol: HIPK2   Gene   UCSC   Ensembl
• Aliases: PRO0593
• Gene name: homeodomain interacting protein kinase 2
• Alternate names: homeodomain-interacting protein kinase 2, hHIPk2,
• Gene location: 7q34 (139777997: 139561569)     Exons: 22     NC_000007.14
• Gene summary(Entrez): This gene encodes a conserved serine/threonine kinase that is a member of the homeodomain-interacting protein kinase family. The encoded protein interacts with homeodomain transcription factors and many other transcription factors such as p53, and can fun
• OMIM: 606868

Protein Summary

• Protein general information: Q9H2X6  
  • Name: Homeodomain interacting protein kinase 2 (hHIPk2) (EC 2.7.11.1)
  • Length: 1198  
  • Mass: 130966
  • Tissue specificity: Highly expressed in heart, muscle and kidney. Weakly expressed in a ubiquitous way. Down-regulated in several thyroid and breast tumors. {ECO
• Sequence:

  MAPVYEGMASHVQVFSPHTLQSSAFCSVKKLKIEPSSNWDMTGYGSHSKVYSQSKNIPLSQPATTTVSTSLPVPN
  PSLPYEQTIVFPGSTGHIVVTSASSTSVTGQVLGGPHNLMRRSTVSLLDTYQKCGLKRKSEEIENTSSVQIIEEH
  PPMIQNNASGATVATATTSTATSKNSGSNSEGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIV
  AIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKY
  IRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILG
  LPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDTDSPYPLWRLKT
  PDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHP
  FVTMTHLLDFPHSTHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFNNQLTTVHNQAPSSTS
  ATISLANPEVSILNYPSTLYQPSAASMAAVAQRSMPLQTGTAQICARPDPFQQALIVCPPGFQGLQASPSKHAGY
  SVRMENAVPIVTQAPGAQPLQIQPGLLAQQAWPSGTQQILLPPAWQQLTGVATHTSVQHATVIPETMAGTQQLAD
  WRNTHAHGSHYNPIMQQPALLTGHVTLPAAQPLNVGVAHVMRQQPTSTTSSRKSKQHQSSVRNVSTCEVSSSQAI
  SSPQRSKRVKENTPPRCAMVHSSPACSTSVTCGWGDVASSTTRERQRQTIVIPDTPSPTVSVITISSDTDEEEEQ
  KHAPTSTVSKQRKNVISCVTVHDSPYSDSSSNTSPYSVQQRAGHNNANAFDTKGSLENHCTGNPRTIIVPPLKTQ
  ASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTD
  RTGSHRRQQAYITPTMAQAPYSFPHNSPSHGTVHPHLAAAAAAAHLPTQPHLYTYTAPAALGSTGTVAHLVASQG
  SARHTVQHTAYPASIVHQVPVSMGPRVLPSPTIHPSQYPAQFAHQTYISASPASTVYTGYPLSPAKVNQYPYI

• Structural information:
  • Protein Domains: (199..52-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 6P5S
  • PDBsum: 6P5S
  • DIP: 31716
  • STRING: ENSP00000385571
• Other Databases: GeneCards:  HIPK2  Malacards:  HIPK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001102	RNA polymerase II activating transcription factor binding	IBA	molecular function
GO:0003713	transcription coactivator activity	IBA	contributes to
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0007224	smoothened signaling pathway	IBA	biological process
GO:0016605	PML body	IBA	colocalizes with
GO:0018107	peptidyl-threonine phosphorylation	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0046332	SMAD binding	IBA	molecular function
GO:0004713	protein tyrosine kinase activity	IBA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IBA	biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0071456	cellular response to hypoxia	TAS	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	TAS	biological process
GO:0030218	erythrocyte differentiation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030578	PML body organization	TAS	biological process
GO:0001654	eye development	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:2000059	negative regulation of ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090575	RNA polymerase II transcription regulator complex	IEA	cellular component
GO:0061072	iris morphogenesis	IEA	biological process
GO:0060059	embryonic retina morphogenesis in camera-type eye	IEA	biological process
GO:0050882	voluntary musculoskeletal movement	IEA	biological process
GO:0043388	positive regulation of DNA binding	IEA	biological process
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA	biological process
GO:0032092	positive regulation of protein binding	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0010842	retina layer formation	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0008344	adult locomotory behavior	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0060235	lens induction in camera-type eye	IEA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0048596	embryonic camera-type eye morphogenesis	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IEA	biological process
GO:0007628	adult walking behavior	IEA	biological process
GO:0007224	smoothened signaling pathway	IEA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0001102	RNA polymerase II activating transcription factor binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001102	RNA polymerase II activating transcription factor binding	ISS	molecular function
GO:0003713	transcription coactivator activity	ISS	contributes to
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0006978	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	IDA	biological process
GO:0016605	PML body	IDA	colocalizes with
GO:0018105	peptidyl-serine phosphorylation	ISS	biological process
GO:0032092	positive regulation of protein binding	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0018107	peptidyl-threonine phosphorylation	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	ISS	biological process
GO:0090575	RNA polymerase II transcription regulator complex	ISS	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0060395	SMAD protein signal transduction	IDA	biological process
GO:0016604	nuclear body	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0046790	virion binding	IPI	molecular function
GO:0046330	positive regulation of JNK cascade	IMP	biological process
GO:0030514	negative regulation of BMP signaling pathway	IMP	biological process
GO:0019048	modulation by virus of host process	NAS	biological process
GO:0016604	nuclear body	TAS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0046332	SMAD binding	IPI	molecular function
GO:0046332	SMAD binding	IPI	molecular function
GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097193	intrinsic apoptotic signaling pathway	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04218	Cellular senescence

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq