• Gene id: 28992

Gene Summary

• Gene Symbol: MACROD1   Gene   UCSC   Ensembl
• Aliases: LRP16
• Gene name: mono-ADP ribosylhydrolase 1
• Alternate names: ADP-ribose glycohydrolase MACROD1, MACRO domain containing 1, MACRO domain-containing protein 1, O-acetyl-ADP-ribose deacetylase MACROD1, [Protein ADP-ribosylaspartate] hydrolase MACROD1, [Protein ADP-ribosylglutamate] hydrolase, [Protein ADP-ribosylglutamate] ,
• Gene location: 11q13.1 (64166651: 63998553)     Exons: 14     NC_000011.10
• OMIM: 110300

Protein Summary

• Protein general information: Q9BQ69  
  • Name: ADP ribose glycohydrolase MACROD1 (MACRO domain containing protein 1) (O acetyl ADP ribose deacetylase MACROD1) (EC 3.1.1.106) (Protein LRP16) ([Protein ADP ribosylaspartate] hydrolase MACROD1) (EC 3.2.2. ) ([Protein ADP ribosylglutamate] hydrolase MACROD
  • Length: 325  
  • Mass: 35505
• Sequence:

  MSLQSRLSGRLAQLRAAGQLLVPPRPRPGHLAGATRTRSSTCGPPAFLGVFGRRARTSAGVGAWGAAAVGRTAGV
  RTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQL
  NEKISLLRSDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGYRLPAKYVIH
  TVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEIVLATLREWLEQHKDKVDR
  LIICVFLEKDEDIYRSRLPHYFPVA

• Structural information:
  • Protein Domains: (141..32-)
    (/note="Macro-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00490"-)
  • Interpro: IPR002589  
  • Prosite: PS51154
  • PDB: 2X47
  • PDBsum: 2X47
  • STRING: ENSP00000255681
• Other Databases: GeneCards:  MACROD1  Malacards:  MACROD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0140293	ADP-ribosylglutamate hydrolase activity	IBA	molecular function
GO:0042278	purine nucleoside metabolic process	IBA	biological process
GO:0019213	deacetylase activity	IBA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IBA	biological process
GO:0140291	peptidyl-glutamate ADP-deribosylation	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0140291	peptidyl-glutamate ADP-deribosylation	IDA	biological process
GO:0140293	ADP-ribosylglutamate hydrolase activity	IDA	molecular function
GO:0051725	protein de-ADP-ribosylation	IDA	biological process
GO:0042278	purine nucleoside metabolic process	IDA	biological process
GO:0019213	deacetylase activity	IDA	molecular function
GO:0016798	hydrolase activity, acting on glycosyl bonds	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq