• Gene id: 28989

Gene Summary

• Gene Symbol: NTMT1   Gene   UCSC   Ensembl
• Aliases: AD-003, C9orf32, HOMT1A, METTL11A, NRMT, NRMT1, NTM1A
• Gene name: N-terminal Xaa-Pro-Lys N-methyltransferase 1
• Alternate names: N-terminal Xaa-Pro-Lys N-methyltransferase 1, N-terminal RCC1 methyltransferase, X-Pro-Lys N-terminal protein methyltransferase 1A, alpha N-terminal protein methyltransferase 1A, methyltransferase-like protein 11A,
• Gene location: 9q34.11 (129608883: 129636741)     Exons: 7     NC_000009.12
• Gene summary(Entrez): The METTL11A gene encodes an N-terminal methyltransferase for the RAN (MIM 601179) guanine nucleotide exchange factor regulator of chromosome condensation 1 (RCC1; MIM 179710). METTL11A enzyme alpha-N-methylates other protein targets such as SET (MIM 6009
• OMIM: 613560

Protein Summary

• Protein general information: Q9BV86  
  • Name: N terminal Xaa Pro Lys N methyltransferase 1 (EC 2.1.1.244) (Alpha N terminal protein methyltransferase 1A) (Methyltransferase like protein 11A) (N terminal RCC1 methyltransferase) (X Pro Lys N terminal protein methyltransferase 1A) (NTM1A) [Cleaved into:
  • Length: 223  
  • Mass: 25387
• Sequence:

  MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGAGIGRI
  TKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFL
  RRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFALR

• Structural information:
  • Interpro: IPR008576  IPR029063  
  • PDB: 2EX4 5CVD 5CVE 5E1B 5E1D 5E1M 5E1O 5E2A 5E2B 6DTN
  • PDBsum: 2EX4 5CVD 5CVE 5E1B 5E1D 5E1M 5E1O 5E2A 5E2B 6DTN
  • DIP: 31241
  • STRING: ENSP00000483489
• Other Databases: GeneCards:  NTMT1  Malacards:  NTMT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071885	N-terminal protein N-methyltransferase activity	IBA	molecular function
GO:0035570	N-terminal peptidyl-serine methylation	IBA	biological process
GO:0035568	N-terminal peptidyl-proline methylation	IBA	biological process
GO:0008168	methyltransferase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0018011	N-terminal peptidyl-alanine methylation	IBA	biological process
GO:0006480	N-terminal protein amino acid methylation	IBA	biological process
GO:0016571	histone methylation	IDA	biological process
GO:0035573	N-terminal peptidyl-serine trimethylation	IDA	biological process
GO:0008276	protein methyltransferase activity	IDA	molecular function
GO:0008276	protein methyltransferase activity	IDA	molecular function
GO:0042054	histone methyltransferase activity	IDA	molecular function
GO:0018013	N-terminal peptidyl-glycine methylation	IDA	biological process
GO:0071885	N-terminal protein N-methyltransferase activity	IDA	molecular function
GO:0035572	N-terminal peptidyl-serine dimethylation	IDA	biological process
GO:0018016	N-terminal peptidyl-proline dimethylation	IDA	biological process
GO:0018016	N-terminal peptidyl-proline dimethylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0007051	spindle organization	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0006480	N-terminal protein amino acid methylation	IEA	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008276	protein methyltransferase activity	IEA	molecular function
GO:0018016	N-terminal peptidyl-proline dimethylation	IEA	biological process
GO:0018012	N-terminal peptidyl-alanine trimethylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R