• Gene id: 28988

Gene Summary

• Gene Symbol: DBNL   Gene   UCSC   Ensembl
• Aliases: ABP1, HIP-55, HIP55, SH3P7
• Gene name: drebrin like
• Alternate names: drebrin-like protein, HPK1-interacting protein of 55 kDa, SH3 domain-containing protein 7, actin-binding protein 1, cervical SH3P7, cervical mucin-associated protein, drebrin-F, src homology 3 domain-containing protein HIP-55,
• Gene location: 7p13 (44044639: 44069455)     Exons: 13     NC_000007.14
• OMIM: 610106

Protein Summary

• Protein general information: Q9UJU6  
  • Name: Drebrin like protein (Cervical SH3P7) (Cervical mucin associated protein) (Drebrin F) (HPK1 interacting protein of 55 kDa) (HIP 55) (SH3 domain containing protein 7)
  • Length: 430  
  • Mass: 48207
• Sequence:

  MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVKDPNSG
  LPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQ
  DVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEEAQRQLEQERRERELREAARREQRYQ
  EQGGEASPQRTWEQQQEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE
  PAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLVQQQGAGSEHIDHHIQGQGLSGQGLC
  ARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGMFPANYVELIE

• Structural information:
  • Protein Domains: (4..13-)
    (/note="ADF-H-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00599-)
    (371..43-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR002108  IPR029006  IPR029923  IPR035717  IPR036028   IPR001452  
  • Prosite: PS51263 PS50002
  • CDD: cd11960
  • PDB: 1X67
  • PDBsum: 1X67
  • STRING: ENSP00000417653
• Other Databases: GeneCards:  DBNL  Malacards:  DBNL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098974	postsynaptic actin cytoskeleton organization	IBA	biological process
GO:0061003	positive regulation of dendritic spine morphogenesis	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0045773	positive regulation of axon extension	IBA	biological process
GO:0030425	dendrite	IBA	cellular component
GO:0048812	neuron projection morphogenesis	IBA	biological process
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0030864	cortical actin cytoskeleton	IBA	cellular component
GO:0030833	regulation of actin filament polymerization	IBA	biological process
GO:0030427	site of polarized growth	IBA	cellular component
GO:0030027	lamellipodium	IBA	cellular component
GO:0014069	postsynaptic density	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005884	actin filament	IBA	colocalizes with
GO:0071800	podosome assembly	ISS	biological process
GO:0051015	actin filament binding	ISS	molecular function
GO:0002102	podosome	ISS	cellular component
GO:0001726	ruffle	ISS	cellular component
GO:0048812	neuron projection morphogenesis	ISS	biological process
GO:0007416	synapse assembly	ISS	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0051015	actin filament binding	IEA	molecular function
GO:0097178	ruffle assembly	IEA	biological process
GO:0006898	receptor-mediated endocytosis	IEA	biological process
GO:0007416	synapse assembly	IEA	biological process
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0008047	enzyme activator activity	TAS	molecular function
GO:0007257	activation of JUN kinase activity	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001726	ruffle	IEA	cellular component
GO:0002102	podosome	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005938	cell cortex	IEA	cellular component
GO:0016601	Rac protein signal transduction	IEA	biological process
GO:0051015	actin filament binding	IEA	molecular function
GO:0071800	podosome assembly	IEA	biological process
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007416	synapse assembly	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0030027	lamellipodium	IEA	cellular component
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030665	clathrin-coated vesicle membrane	IEA	cellular component
GO:0002102	podosome	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016601	Rac protein signal transduction	ISS	biological process
GO:0030027	lamellipodium	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005938	cell cortex	ISS	cellular component
GO:0003779	actin binding	ISS	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R