• Gene id: 28985

Gene Summary

• Gene Symbol: MCTS1   Gene   UCSC   Ensembl
• Aliases: MCT-1, MCT1
• Gene name: MCTS1 re-initiation and release factor
• Alternate names: malignant T-cell-amplified sequence 1, malignant T-cell amplified sequence 1, multiple copies T-cell malignancies, multiple copies in T-cell lymphoma-1,
• Gene location: Xq24 (120604100: 120621158)     Exons: 7     NC_000023.11
• OMIM: 300587

Protein Summary

• Protein general information: Q9ULC4  
  • Name: Malignant T cell amplified sequence 1 (MCT 1) (Multiple copies T cell malignancies)
  • Length: 181  
  • Mass: 20555
  • Tissue specificity: Ubiquitous. Over-expressed in T-cell lymphoid cell lines and in non-Hodgkin lymphoma cell lines as well as in a subset of primary large B-cell lymphomas. {ECO
• Sequence:

  MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQRE
  GPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKM
  SAEDIEKVNKGIGIENIHYLNDGLWHMKTYK

• Structural information:
  • Protein Domains: (92..17-)
    (/note="PUA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00161"-)
  • Interpro: IPR016437  IPR041366  IPR002478  IPR015947  IPR036974   IPR004521  
  • Prosite: PS50890
  • PDB: 3R90 5ONS 5VYC 6MS4
  • PDBsum: 3R90 5ONS 5VYC 6MS4
  • STRING: ENSP00000360365
• Other Databases: GeneCards:  MCTS1  Malacards:  MCTS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002188	translation reinitiation	IBA	biological process
GO:0001731	formation of translation preinitiation complex	IBA	biological process
GO:0032790	ribosome disassembly	IDA	biological process
GO:0001731	formation of translation preinitiation complex	IDA	biological process
GO:0022627	cytosolic small ribosomal subunit	IDA	colocalizes with
GO:0075522	IRES-dependent viral translational initiation	IDA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0006413	translational initiation	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)