• Gene id: 28984

Gene Summary

• Gene Symbol: RGCC   Gene   UCSC   Ensembl
• Aliases: C13orf15, RGC-32, RGC32, bA157L14.2
• Gene name: regulator of cell cycle
• Alternate names: regulator of cell cycle RGCC, response gene to complement 32 protein,
• Gene location: 13q14.11 (41457410: 41470875)     Exons: 7     NC_000013.11
• Gene summary(Entrez): This gene is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during
• OMIM: 610077

Protein Summary

• Protein general information: Q9H4X1  
  • Name: Regulator of cell cycle RGCC (Response gene to complement 32 protein) (RGC 32)
  • Length: 137  
  • Mass: 14559
  • Tissue specificity: Detected in brain, heart and liver (at protein level). Highly expressed in liver, skeletal muscle, kidney and pancreas. Detected at lower levels in heart, brain and placenta. Detected in aorta endothelial cells. Overexpressed in colon,
• Sequence:

  MKPPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFS
  DSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM

• Structural information:
  • Interpro: IPR029252  
  • STRING: ENSP00000368664
• Other Databases: GeneCards:  RGCC  Malacards:  RGCC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030295	protein kinase activator activity	IBA	molecular function
GO:0019901	protein kinase binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0072537	fibroblast activation	ISS	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:2000573	positive regulation of DNA biosynthetic process	IEA	biological process
GO:0072537	fibroblast activation	IEA	biological process
GO:1900087	positive regulation of G1/S transition of mitotic cell cycle	IMP	biological process
GO:0030295	protein kinase activator activity	IDA	molecular function
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	ISS	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0070412	R-SMAD binding	IPI	molecular function
GO:0001937	negative regulation of endothelial cell proliferation	IDA	biological process
GO:0003331	positive regulation of extracellular matrix constituent secretion	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0051496	positive regulation of stress fiber assembly	IDA	biological process
GO:0090272	negative regulation of fibroblast growth factor production	IDA	biological process
GO:1901203	positive regulation of extracellular matrix assembly	IDA	biological process
GO:0001100	negative regulation of exit from mitosis	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0010718	positive regulation of epithelial to mesenchymal transition	IDA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	biological process
GO:0032967	positive regulation of collagen biosynthetic process	IDA	biological process
GO:0043537	negative regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0071158	positive regulation of cell cycle arrest	IDA	biological process
GO:0071850	mitotic cell cycle arrest	IDA	biological process
GO:1901991	negative regulation of mitotic cell cycle phase transition	IDA	biological process
GO:2000048	negative regulation of cell-cell adhesion mediated by cadherin	IDA	biological process
GO:2000048	negative regulation of cell-cell adhesion mediated by cadherin	IDA	biological process
GO:2000353	positive regulation of endothelial cell apoptotic process	IDA	biological process
GO:0006956	complement activation	IMP	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0050710	negative regulation of cytokine secretion	IMP	biological process
GO:0050715	positive regulation of cytokine secretion	IMP	biological process
GO:0071456	cellular response to hypoxia	IMP	biological process
GO:0010718	positive regulation of epithelial to mesenchymal transition	IMP	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IMP	biological process
GO:0045840	positive regulation of mitotic nuclear division	IMP	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IMP	biological process
GO:2000573	positive regulation of DNA biosynthetic process	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R