• Gene id: 28983

Gene Summary

• Gene Symbol: TMPRSS11E   Gene   UCSC   Ensembl
• Aliases: DESC1, TMPRSS11E2
• Gene name: transmembrane serine protease 11E
• Alternate names: transmembrane protease serine 11E, serine protease DESC1, transmembrane protease serine 11E2, transmembrane protease, serine 11E,
• Gene location: 4q13.2 (68447462: 68497603)     Exons: 6     NC_000004.12
• OMIM: 610399

Protein Summary

• Protein general information: Q9UL52  
  • Name: Transmembrane protease serine 11E (EC 3.4.21. ) (Serine protease DESC1) (Transmembrane protease serine 11E2) [Cleaved into: Transmembrane protease serine 11E non catalytic chain; Transmembrane protease serine 11E catalytic chain]
  • Length: 423  
  • Mass: 47696
  • Tissue specificity: Expression can only be detected in tissues derived from the head and neck, and in skin, prostate and testis. {ECO
• Sequence:

  MMYRPDVVRARKRVCWEPWVIGLVIFISLIVLAVCIGLTVHYVRYNQKKTYNYYSTLSFTTDKLYAEFGREASNN
  FTEMSQRLESMVKNAFYKSPLREEFVKSQVIKFSQQKHGVLAHMLLICRFHSTEDPETVDKIVQLVLHEKLQDAV
  GPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGGTEVEEGEWPWQASLQWDGSHRCGATLINAT
  WLVSAAHCFTTYKNPARWTASFGVTIKPSKMKRGLRRIIVHEKYKHPSHDYDISLAELSSPVPYTNAVHRVCLPD
  ASYEFQPGDVMFVTGFGALKNDGYSQNHLRQAQVTLIDATTCNEPQAYNDAITPRMLCAGSLEGKTDACQGDSGG
  PLVSSDARDIWYLAGIVSWGDECAKPNKPGVYTRVTALRDWITSKTGI

• Structural information:
  • Protein Domains: (49..16-)
    (/note="SEA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00188-)
    (192..42-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR017329  IPR009003  IPR001314  IPR000082  IPR036364   IPR001254  IPR018114  IPR033116  
  • Prosite: PS50024 PS50240 PS00134 PS00135
  • CDD: cd00190
  • PDB: 2OQ5
  • PDBsum: 2OQ5
  • STRING: ENSP00000307519
• Other Databases: GeneCards:  TMPRSS11E  Malacards:  TMPRSS11E

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0006508	proteolysis	ISS	biological process
GO:0050890	cognition	IMP	biological process
GO:0008236	serine-type peptidase activity	ISS	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)