• Gene id: 2898

Gene Summary

• Gene Symbol: GRIK2   Gene   UCSC   Ensembl
• Aliases: EAA4, GLR6, GLUK6, GLUR6, GluK2, MRT6
• Gene name: glutamate ionotropic receptor kainate type subunit 2
• Alternate names: glutamate receptor ionotropic, kainate 2, bA487F5.1, excitatory amino acid receptor 4, gluR-6, glutamate receptor 6, glutamate receptor form A, glutamate receptor form B, glutamate receptor form C, glutamate receptor form D, glutamate receptor form E,
• Gene location: 6q16.3 (101393707: 102070082)     Exons: 22     NC_000006.12
• Gene summary(Entrez): Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are com
• OMIM: 602717

Protein Summary

• Protein general information: Q13002  
  • Name: Glutamate receptor ionotropic, kainate 2 (GluK2) (Excitatory amino acid receptor 4) (EAA4) (Glutamate receptor 6) (GluR 6) (GluR6)
  • Length: 908  
  • Mass: 102583
  • Tissue specificity: Expression is higher in cerebellum than in cerebral cortex.
• Sequence:

  MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTT
  LTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLY
  PDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFH
  VIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
  LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGRI
  TFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSD
  KPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREK
  VIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
  VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLA
  KQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNC
  NLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFI
  VLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRR
  LPGKETMA

• Structural information:
  • Interpro: IPR001828  IPR019594  IPR001508  IPR001320  IPR028082  
  • PDB: 3QXM 5CMM
  • PDBsum: 3QXM 5CMM
  • STRING: ENSP00000397026
• Other Databases: GeneCards:  GRIK2  Malacards:  GRIK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904315	transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential	IBA	molecular function
GO:0098839	postsynaptic density membrane	IBA	cellular component
GO:0042734	presynaptic membrane	IBA	cellular component
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0035249	synaptic transmission, glutamatergic	IBA	biological process
GO:0015277	kainate selective glutamate receptor activity	IBA	molecular function
GO:0015276	ligand-gated ion channel activity	IBA	molecular function
GO:0050804	modulation of chemical synaptic transmission	IBA	biological process
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0032983	kainate selective glutamate receptor complex	IBA	cellular component
GO:0008066	glutamate receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005234	extracellularly glutamate-gated ion channel activity	IMP	molecular function
GO:0004970	ionotropic glutamate receptor activity	IEA	molecular function
GO:0015276	ligand-gated ion channel activity	IEA	molecular function
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015277	kainate selective glutamate receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007215	glutamate receptor signaling pathway	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0001662	behavioral fear response	IEA	biological process
GO:0004970	ionotropic glutamate receptor activity	IEA	molecular function
GO:0006874	cellular calcium ion homeostasis	IEA	biological process
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0015277	kainate selective glutamate receptor activity	IEA	molecular function
GO:0019228	neuronal action potential	IEA	biological process
GO:0035249	synaptic transmission, glutamatergic	IEA	biological process
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099507	ligand-gated ion channel activity involved in regulation of presynaptic membrane potential	IEA	molecular function
GO:1904315	transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential	IEA	molecular function
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0008328	ionotropic glutamate receptor complex	IEA	cellular component
GO:0015277	kainate selective glutamate receptor activity	IEA	molecular function
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0043195	terminal bouton	IEA	cellular component
GO:0046328	regulation of JNK cascade	IEA	biological process
GO:0051402	neuron apoptotic process	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0032983	kainate selective glutamate receptor complex	IEA	cellular component
GO:0042391	regulation of membrane potential	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0048169	regulation of long-term neuronal synaptic plasticity	IEA	biological process
GO:0048172	regulation of short-term neuronal synaptic plasticity	IEA	biological process
GO:0051967	negative regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060080	inhibitory postsynaptic potential	IEA	biological process
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0008066	glutamate receptor activity	IEA	molecular function
GO:0030165	PDZ domain binding	IEA	molecular function
GO:0031624	ubiquitin conjugating enzyme binding	IEA	molecular function
GO:0032839	dendrite cytoplasm	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0043113	receptor clustering	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0051967	negative regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0099505	regulation of presynaptic membrane potential	IEA	biological process
GO:0035235	ionotropic glutamate receptor signaling pathway	IEA	biological process
GO:0035235	ionotropic glutamate receptor signaling pathway	IEA	biological process
GO:0035235	ionotropic glutamate receptor signaling pathway	IEA	biological process
GO:0035235	ionotropic glutamate receptor signaling pathway	IEA	biological process
GO:0035235	ionotropic glutamate receptor signaling pathway	IEA	biological process
GO:0035235	ionotropic glutamate receptor signaling pathway	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0050804	modulation of chemical synaptic transmission	IDA	biological process
GO:0015277	kainate selective glutamate receptor activity	IDA	molecular function
GO:0050806	positive regulation of synaptic transmission	IMP	biological process
GO:0048172	regulation of short-term neuronal synaptic plasticity	IMP	biological process
GO:0120169	detection of cold stimulus involved in thermoception	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04724	Glutamatergic synapse

Diseases

Associated diseases	References
Autosomal recessive mental retardation	KEGG:H00768
Autosomal recessive mental retardation	KEGG:H00768
Huntington's disease	PMID:10522893
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq