• Gene id: 28978

Gene Summary

• Gene Symbol: TMEM14A   Gene   UCSC   Ensembl
• Aliases: C6orf73, PTD011
• Gene name: transmembrane protein 14A
• Alternate names: transmembrane protein 14A,
• Gene location: 6p12.2 (75131964: 75130224)     Exons: 5     NC_000017.11
• OMIM: 616870

Protein Summary

• Protein general information: Q9Y6G1  
  • Name: Transmembrane protein 14A
  • Length: 99  
  • Mass: 10712
  • Tissue specificity: Expressed at significantly higher levels in ovarian cancer tissues than in normal tissues (at protein level). {ECO
• Sequence:

  MDLIGFGYAALVTFGSIFGYKRRGGVPSLIAGLFVGCLAGYGAYRVSNDKRDVKVSLFTAFFLATIMGVRFKRSK
  KIMPAGLVAGLSLMMILRLVLLLL

• Structural information:
  • Interpro: IPR005349  
  • PDB: 2LOO 2LOP
  • PDBsum: 2LOO 2LOP
  • STRING: ENSP00000211314
• Other Databases: GeneCards:  TMEM14A  Malacards:  TMEM14A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006839	mitochondrial transport	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0031966	mitochondrial membrane	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:1901029	negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:1901029	negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)