About Us

Search Result


Gene id 28977
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol MRPL42   Gene   UCSC   Ensembl
Aliases HSPC204, L31MT, L42MT, MRP-L31, MRP-L42, MRP-S32, MRPL31, MRPS32, PTD007, RPML31, S32MT
Gene name mitochondrial ribosomal protein L42
Alternate names 39S ribosomal protein L42, mitochondrial, 28S ribosomal protein S32, mitochondrial, 39S ribosomal protein L31, mitochondrial, mitochondrial large ribosomal subunit protein mL42,
Gene location 12q22 (93467513: 93516213)     Exons: 7     NC_000012.12
Gene summary(Entrez) Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
OMIM 611847

Protein Summary

Protein general information Q9Y6G3  

Name: 39S ribosomal protein L42, mitochondrial (L42mt) (MRP L42) (39S ribosomal protein L31, mitochondrial) (L31mt) (MRP L31) (Mitochondrial large ribosomal subunit protein mL42)

Length: 142  Mass: 16661

Sequence MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPI
PRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
Structural information
Interpro:  IPR019346  

PDB:  
3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
PDBsum:   3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
STRING:   ENSP00000449884
Other Databases GeneCards:  MRPL42  Malacards:  MRPL42

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract