• Gene id: 28960

Gene Summary

• Gene Symbol: DCPS   Gene   UCSC   Ensembl
• Aliases: ARS, DCS1, HINT-5, HINT5, HSL1, HSPC015
• Gene name: decapping enzyme, scavenger
• Alternate names: m7GpppX diphosphatase, 5'-(N(7)-methyl 5'-triphosphoguanosine)-[mRNA] diphosphatase, decapping scavenger enzyme, epididymis secretory sperm binding protein, heat shock-like protein 1, hint-related 7meGMP-directed hydrolase, histidine triad nucleotide-binding pr,
• Gene location: 11q24.2 (126304059: 126350004)     Exons: 6     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the histidine triad family of pyrophosphatases that removes short mRNA fragments containing the 5′ mRNA cap structure, which appear in the 3′ → 5′ mRNA decay pathway, following deadenylation and exosom
• OMIM: 616383

Protein Summary

• Protein general information: Q96C86  
  • Name: m7GpppX diphosphatase (EC 3.6.1.59) (DCS 1) (Decapping scavenger enzyme) (Hint related 7meGMP directed hydrolase) (Histidine triad nucleotide binding protein 5) (Histidine triad protein member 5) (HINT 5) (Scavenger mRNA decapping enzyme DcpS)
  • Length: 337  
  • Mass: 38609
  • Tissue specificity: Detected in liver, brain, kidney, testis and prostate. {ECO
• Sequence:

  MADAAPQLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASGDG
  DGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRL
  IRETGDDYRNITLPHLESQSLSIQWVYNILDKKAEADRIVFENPDPSDGFVLIPDLKWNQQQLDDLYLIAICHRR
  GIRSLRDLTPEHLPLLRNILHQGQEAILQRYRMKGDHLRVYLHYLPSYYHLHVHFTALGFEAPGSGVERAHLLAE
  VIENLECDPRHYQQRTLTFALRADDPLLKLLQEAQQS

• Structural information:
  • Interpro: IPR008594  IPR019808  IPR036265  IPR011145  
  • Prosite: PS00892
  • PDB: 1ST0 1ST4 1XML 1XMM 3BL7 3BL9 3BLA 4QDE 4QDV 4QEB 5OSY
  • PDBsum: 1ST0 1ST4 1XML 1XMM 3BL7 3BL9 3BLA 4QDE 4QDV 4QEB 5OSY
  • STRING: ENSP00000263579
• Other Databases: GeneCards:  DCPS  Malacards:  DCPS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	TAS	biological process
GO:0004532	exoribonuclease activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0050072	m7G(5')pppN diphosphatase activity	IBA	molecular function
GO:0000932	P-body	IBA	cellular component
GO:0000340	RNA 7-methylguanosine cap binding	IBA	molecular function
GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0050072	m7G(5')pppN diphosphatase activity	IDA	molecular function
GO:0050072	m7G(5')pppN diphosphatase activity	IDA	molecular function
GO:0050072	m7G(5')pppN diphosphatase activity	IDA	molecular function
GO:0050072	m7G(5')pppN diphosphatase activity	IDA	molecular function
GO:0050072	m7G(5')pppN diphosphatase activity	IDA	molecular function
GO:0050072	m7G(5')pppN diphosphatase activity	IDA	molecular function
GO:0043069	negative regulation of programmed cell death	IDA	biological process
GO:0000340	RNA 7-methylguanosine cap binding	IDA	molecular function
GO:0000340	RNA 7-methylguanosine cap binding	IDA	molecular function
GO:0000340	RNA 7-methylguanosine cap binding	IDA	molecular function
GO:0000340	RNA 7-methylguanosine cap binding	IDA	molecular function
GO:0000340	RNA 7-methylguanosine cap binding	IDA	molecular function
GO:0045292	mRNA cis splicing, via spliceosome	IDA	biological process
GO:0036245	cellular response to menadione	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000288	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	TAS	biological process
GO:0000288	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	TAS	biological process
GO:0000288	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	TAS	biological process
GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Al-Raqad syndrome	KEGG:H01878
Al-Raqad syndrome	KEGG:H01878
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881