Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 2896
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol GRN   Gene   UCSC   Ensembl
Aliases CLN11, GEP, GP88, PCDGF, PEPI, PGRN
Gene name granulin precursor
Alternate names progranulin, PC cell-derived growth factor, acrogranin, epithelin, glycoprotein 88, glycoprotein of 88 Kda, granulin-epithelin, granulins, proepithelin,
Gene location 17q21.31 (44345301: 44353105)     Exons: 14     NC_000017.11
Gene summary(Entrez) Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin
OMIM 617428

Protein Summary
Protein general information P28799  

Name: Progranulin (PGRN) (Acrogranin) (Epithelin precursor) (Glycoprotein of 88 Kda) (GP88) (Glycoprotein 88) (Granulin precursor) (PC cell derived growth factor) (PCDGF) (Proepithelin) (PEPI) [Cleaved into: Paragranulin; Granulin 1 (Granulin G); Granulin 2 (Gr

Length: 593  Mass: 63544

Tissue specificity: In myelogenous leukemic cell lines of promonocytic, promyelocytic, and proerythroid lineage, in fibroblasts, and very strongly in epithelial cell lines. Present in inflammatory cells and bone marrow. Highest levels in kidney.

Sequence MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIF
TVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCC
PMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELP
SGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQ
SGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSS
DTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSC
PVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGH
FCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL
Structural information
Interpro:  IPR000118  IPR039036  IPR037277  
Prosite:   PS00799

PDB:  		 1G26 2JYE 2JYT 2JYU 2JYV
PDBsum:   1G26 2JYE 2JYT 2JYU 2JYV

DIP:  
41742
MINT:  
STRING:   ENSP00000053867
Other Databases GeneCards:  GRN  Malacards:  GRN

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005615 extracellular space
 IDA cellular component
GO:0030335 positive regulation of ce
ll migration
 IMP biological process
GO:0051960 regulation of nervous sys
tem development
 IBA biological process
GO:0050727 regulation of inflammator
y response
 IBA biological process
GO:0005576 extracellular region
 IBA cellular component
GO:0005764 lysosome
 IDA cellular component
GO:0005764 lysosome
 IDA cellular component
GO:0005764 lysosome
 IDA cellular component
GO:0005783 endoplasmic reticulum
 IDA cellular component
GO:0005576 extracellular region
 IDA cellular component
GO:0005794 Golgi apparatus
 IDA cellular component
GO:0005783 endoplasmic reticulum
 IDA cellular component
GO:0005764 lysosome
 IDA cellular component
GO:0005765 lysosomal membrane
 IDA cellular component
GO:0005576 extracellular region
 IDA cellular component
GO:0050679 positive regulation of ep
ithelial cell proliferati
on
 IDA biological process
GO:1902564 negative regulation of ne
utrophil activation
 IDA biological process
GO:0060266 negative regulation of re
spiratory burst involved
in inflammatory response
 IDA biological process
GO:0051087 chaperone binding
 IDA molecular function
GO:0005770 late endosome
 IDA cellular component
GO:0016020 membrane
 IDA cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0043524 negative regulation of ne
uron apoptotic process
 IDA biological process
GO:1905673 positive regulation of ly
sosome organization
 IDA biological process
GO:1905247 positive regulation of as
partic-type peptidase act
ivity
 ISS biological process
GO:0048680 positive regulation of ax
on regeneration
 ISS biological process
GO:0005802 trans-Golgi network
 ISS cellular component
GO:1903334 positive regulation of pr
otein folding
 ISS biological process
GO:0007040 lysosome organization
 ISS biological process
GO:1900426 positive regulation of de
fense response to bacteri
um
 ISS biological process
GO:0002265 astrocyte activation invo
lved in immune response
 ISS biological process
GO:0106016 positive regulation of in
flammatory response to wo
unding
 ISS biological process
GO:0010595 positive regulation of en
dothelial cell migration
 ISS biological process
GO:0050821 protein stabilization
 IMP biological process
GO:1905247 positive regulation of as
partic-type peptidase act
ivity
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0007041 lysosomal transport
 ISS biological process
GO:1903979 negative regulation of mi
croglial cell activation
 ISS biological process
GO:0043525 positive regulation of ne
uron apoptotic process
 ISS biological process
GO:0002282 microglial cell activatio
n involved in immune resp
onse
 ISS biological process
GO:0045766 positive regulation of an
giogenesis
 ISS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0007041 lysosomal transport
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0007042 lysosomal lumen acidifica
tion
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005615 extracellular space
 IEA cellular component
GO:0005764 lysosome
 IEA cellular component
GO:0005125 cytokine activity
 IEA molecular function
GO:0005576 extracellular region
 IEA cellular component
GO:0008083 growth factor activity
 TAS molecular function
GO:0007165 signal transduction
 NAS biological process
GO:0043312 neutrophil degranulation
 TAS biological process
GO:0005576 extracellular region
 TAS cellular component
GO:0035578 azurophil granule lumen
 TAS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005576 extracellular region
 IEA cellular component
GO:0005764 lysosome
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IDA cellular component
GO:0005764 lysosome
 IDA cellular component
GO:0005768 endosome
 IDA cellular component
GO:0070062 extracellular exosome
 HDA cellular component
GO:0003723 RNA binding
 HDA molecular function

Diseases

Expand All | Collapse All
Associated diseases References
Neuronal ceroid lipofuscinosis KEGG:H00149
Frontotemporal lobar degeneration KEGG:H00078
Neuronal ceroid lipofuscinosis KEGG:H00149
Frontotemporal lobar degeneration KEGG:H00078
Primary progressive multiple sclerosis PMID:21613335
Primary progressive multiple sclerosis PMID:20463744
Alzheimer's disease PMID:20142525
Alzheimer's disease PMID:19016491
Alzheimer's disease PMID:18565828
Alzheimer's disease PMID:20197700
autistic disorder PMID:21892962
Dementia PMID:21220649
Parkinson's disease PMID:23398167
Atherosclerosis PMID:19321167
Multiple sclerosis PMID:21613335
Multiple sclerosis PMID:21613335
Bipolar disorder PMID:24581833
Amyotrophic lateral sclerosis PMID:21107132
Amyotrophic lateral sclerosis PMID:18184915
Frontotemporal dementia PMID:16862116
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract