• Gene id: 28957

Gene Summary

• Gene Symbol: MRPS28   Gene   UCSC   Ensembl
• Aliases: HSPC007, MRP-S28, MRP-S35, MRPS35
• Gene name: mitochondrial ribosomal protein S28
• Alternate names: 28S ribosomal protein S28, mitochondrial, 28S ribosomal protein S35, mitochondrial, S28mt, S35mt, mitochondrial 28S ribosomal protein S35, mitochondrial small ribosomal subunit protein bS1m,
• Gene location: 8q21.13 (53909424: 53943943)     Exons: 6     NC_000019.10
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611990

Protein Summary

• Protein general information: Q9Y2Q9  
  • Name: 28S ribosomal protein S28, mitochondrial (MRP S28) (S28mt) (28S ribosomal protein S35, mitochondrial) (MRP S35) (S35mt) (Mitochondrial small ribosomal subunit protein bS1m)
  • Length: 187  
  • Mass: 20843
• Sequence:

  MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPK
  NVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELT
  SRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK

• Structural information:
  • Interpro: IPR019375  
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000276585
• Other Databases: GeneCards:  MRPS28  Malacards:  MRPS28

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005763	mitochondrial small ribosomal subunit	IBA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005763	mitochondrial small ribosomal subunit	TAS	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881