About Us

Search Result


Gene id 28954
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol REM1   Gene   UCSC   Ensembl
Aliases GD:REM, GES
Gene name RRAD and GEM like GTPase 1
Alternate names GTP-binding protein REM 1, GTPase-regulating endothelial cell sprouting, RAS (RAD and GEM)-like GTP-binding 1,
Gene location 20q11.21 (31475272: 31484894)     Exons: 5     NC_000020.11
Gene summary(Entrez) The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells. [
OMIM 601642

Protein Summary

Protein general information O75628  

Name: GTP binding protein REM 1 (GTPase regulating endothelial cell sprouting) (Rad and Gem like GTP binding protein 1)

Length: 298  Mass: 32947

Tissue specificity: Most highly expressed in the endothelial lining of the blood vessels in uterus and heart. Lower levels found in spleen, lymph node, kidney and testis. Also found in cells with secretory function such as the islets of Langerhans, lobule

Sequence MTLNTEQEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEG
SWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERTLTVDGEDTTLVVVDTWEAEKLDKSWSQESC
LQGGSAYVIVYSIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETS
ATLQHNVAELFEGVVRQLRLRRRDSAAKEPPAPRRPASLAQRARRFLARLTARSARRRALKARSKSCHNLAVL
Structural information
Interpro:  IPR027417  IPR017358  IPR005225  IPR001806  IPR020849  
Prosite:   PS51421

PDB:  
2NZJ
PDBsum:   2NZJ
STRING:   ENSP00000201979
Other Databases GeneCards:  REM1  Malacards:  REM1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005525 GTP binding
IBA molecular function
GO:0005246 calcium channel regulator
activity
IBA molecular function
GO:0005886 plasma membrane
IBA cellular component
GO:0003924 GTPase activity
IEA molecular function
GO:0005525 GTP binding
IEA molecular function
GO:0007165 signal transduction
IEA biological process
GO:0016020 membrane
IEA cellular component
GO:1901842 negative regulation of hi
gh voltage-gated calcium
channel activity
IEA biological process
GO:0005516 calmodulin binding
IEA molecular function
GO:0005525 GTP binding
IEA molecular function
GO:0000166 nucleotide binding
IEA molecular function
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract