• Gene id: 28954

Gene Summary

• Gene Symbol: REM1   Gene   UCSC   Ensembl
• Aliases: GD:REM, GES
• Gene name: RRAD and GEM like GTPase 1
• Alternate names: GTP-binding protein REM 1, GTPase-regulating endothelial cell sprouting, RAS (RAD and GEM)-like GTP-binding 1,
• Gene location: 20q11.21 (31475272: 31484894)     Exons: 5     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells. [
• OMIM: 601642

Protein Summary

• Protein general information: O75628  
  • Name: GTP binding protein REM 1 (GTPase regulating endothelial cell sprouting) (Rad and Gem like GTP binding protein 1)
  • Length: 298  
  • Mass: 32947
  • Tissue specificity: Most highly expressed in the endothelial lining of the blood vessels in uterus and heart. Lower levels found in spleen, lymph node, kidney and testis. Also found in cells with secretory function such as the islets of Langerhans, lobule
• Sequence:

  MTLNTEQEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEG
  SWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERTLTVDGEDTTLVVVDTWEAEKLDKSWSQESC
  LQGGSAYVIVYSIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETS
  ATLQHNVAELFEGVVRQLRLRRRDSAAKEPPAPRRPASLAQRARRFLARLTARSARRRALKARSKSCHNLAVL

• Structural information:
  • Interpro: IPR027417  IPR017358  IPR005225  IPR001806  IPR020849  
  • Prosite: PS51421
  • PDB: 2NZJ
  • PDBsum: 2NZJ
  • STRING: ENSP00000201979
• Other Databases: GeneCards:  REM1  Malacards:  REM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005525	GTP binding	IBA	molecular function
GO:0005246	calcium channel regulator activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:1901842	negative regulation of high voltage-gated calcium channel activity	IEA	biological process
GO:0005516	calmodulin binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881