• Gene id: 2895

Gene Summary

• Gene Symbol: GRID2   Gene   UCSC   Ensembl
• Aliases: GluD2, SCAR18
• Gene name: glutamate ionotropic receptor delta type subunit 2
• Alternate names: glutamate receptor ionotropic, delta-2, gluR delta-2 subunit, glutamate receptor delta-2 subunit, glutamate receptor, ionotropic, delta 2,
• Gene location: 4q22.1-q22.2 (92303621: 93810414)     Exons: 27     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the family of ionotropic glutamate receptors which are the predominant excitatory neurotransmitter receptors in the mammalian brain. The encoded protein is a multi-pass membrane protein that is expressed sel
• OMIM: 606424

Protein Summary

• Protein general information: O43424  
  • Name: Glutamate receptor ionotropic, delta 2 (GluD2) (GluR delta 2 subunit)
  • Length: 1007  
  • Mass: 113356
• Sequence:

  MEVFPFLLVLSVWWSRTWDSANADSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQTEKITFSVTFVDGNNP
  FQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTRSNRNDDYTLSVRPPV
  YLHDVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRD
  TLRRAILVMNPATAKSFITEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFR
  GNHRISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSKPWQGGRSMLETIKK
  GGVSGLTGELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWNPVTGLNGSLTDKKLENNMRGVVLRVVTVLE
  EPFVMVSENVLGKPKKYQGFSIDVLDALSNYLGFNYEIYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALT
  ITPDRENVVDFTTRYMDYSVGVLLRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSM
  TSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITRIESSIQSLQDLSKQT
  EIPYGTVLDSAVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSENNVLESQAGIQKVKYGNYAFVWDAAVLEYVA
  INDPDCSFYTIGNTVADRGYGIALQHGSPYRDVFSQRILELQQNGDMDILKHKWWPKNGQCDLYSSVDTKQKGGA
  LDIKSFAGVFCILAAGIVLSCFIAMLETWWNKRKGSRVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSI
  DLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFF
  RSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI

• Structural information:
  • Interpro: IPR001828  IPR019594  IPR001508  IPR001320  IPR028082  
  • PDB: 5KC8 5KCA
  • PDBsum: 5KC8 5KCA
  • STRING: ENSP00000282020
• Other Databases: GeneCards:  GRID2  Malacards:  GRID2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0008066	glutamate receptor activity	IBA	molecular function
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0050804	modulation of chemical synaptic transmission	IBA	biological process
GO:0015276	ligand-gated ion channel activity	IBA	molecular function
GO:0035249	synaptic transmission, glutamatergic	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0098839	postsynaptic density membrane	IBA	cellular component
GO:1904315	transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential	IBA	molecular function
GO:0051965	positive regulation of synapse assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1900454	positive regulation of long-term synaptic depression	IMP	biological process
GO:1904861	excitatory synapse assembly	IMP	biological process
GO:0004970	ionotropic glutamate receptor activity	IEA	molecular function
GO:0015276	ligand-gated ion channel activity	IEA	molecular function
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008066	glutamate receptor activity	TAS	molecular function
GO:0007215	glutamate receptor signaling pathway	TAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098688	parallel fiber to Purkinje cell synapse	IEA	cellular component
GO:0043523	regulation of neuron apoptotic process	IEA	biological process
GO:0036477	somatodendritic compartment	IEA	cellular component
GO:0035249	synaptic transmission, glutamatergic	IEA	biological process
GO:0010975	regulation of neuron projection development	IEA	biological process
GO:0008328	ionotropic glutamate receptor complex	IEA	cellular component
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IEA	biological process
GO:0099151	regulation of postsynaptic density assembly	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0097110	scaffold protein binding	IEA	molecular function
GO:0060134	prepulse inhibition	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0034613	cellular protein localization	IEA	biological process
GO:0030165	PDZ domain binding	IEA	molecular function
GO:0021707	cerebellar granule cell differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030165	PDZ domain binding	ISS	molecular function
GO:0097110	scaffold protein binding	ISS	molecular function
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	ISS	biological process
GO:0008328	ionotropic glutamate receptor complex	ISS	cellular component
GO:0035249	synaptic transmission, glutamatergic	ISS	biological process
GO:0043523	regulation of neuron apoptotic process	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0021707	cerebellar granule cell differentiation	ISS	biological process
GO:0034613	cellular protein localization	ISS	biological process
GO:0043197	dendritic spine	ISS	cellular component
GO:0045202	synapse	ISS	cellular component
GO:0060079	excitatory postsynaptic potential	ISS	biological process
GO:0060134	prepulse inhibition	ISS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0035235	ionotropic glutamate receptor signaling pathway	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04730	Long-term depression

Diseases

Associated diseases	References
Autosomal recessive spinocerebellar ataxias	KEGG:H01891
Autosomal recessive spinocerebellar ataxias	KEGG:H01891
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray