• Gene id: 2891

Gene Summary

• Gene Symbol: GRIA2   Gene   UCSC   Ensembl
• Aliases: GLUR2, GLURB, GluA2, GluR-K2, HBGR2, gluR-2, gluR-B
• Gene name: glutamate ionotropic receptor AMPA type subunit 2
• Alternate names: glutamate receptor 2, AMPA-selective glutamate receptor 2, glutamate receptor B flip isoform, glutamate receptor, ionotropic, AMPA 2,
• Gene location: 4q32.1 (157220583: 157370582)     Exons: 30     NC_000004.12
• Gene summary(Entrez): Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to a family of glutamate receptors that are sensitive to al
• OMIM: 138247

Protein Summary

• Protein general information: P42262  
  • Name: Glutamate receptor 2 (GluR 2) (AMPA selective glutamate receptor 2) (GluR B) (GluR K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)
  • Length: 883  
  • Mass: 98821
• Sequence:

  MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTN
  AFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAY
  LYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVIT
  IGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
  YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINI
  MELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLA
  AEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMI
  KKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
  SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGS
  TKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDS
  KGYGIATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLG
  LAMLVALIEFCYKSRAEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI

• Structural information:
  • Interpro: IPR001828  IPR019594  IPR001508  IPR001320  IPR028082  
  • PDB: 2WJW 2WJX 2XHD 3R7X 3RN8 3RNN 3UA8 5H8S 5YBF 5YBG 5ZG0 5ZG1 5ZG2 5ZG3
  • PDBsum: 2WJW 2WJX 2XHD 3R7X 3RN8 3RNN 3UA8 5H8S 5YBF 5YBG 5ZG0 5ZG1 5ZG2 5ZG3
  • DIP: 42852
  • STRING: ENSP00000296526
• Other Databases: GeneCards:  GRIA2  Malacards:  GRIA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	NAS	molecular function
GO:0001540	amyloid-beta binding	ISS	molecular function
GO:0004971	AMPA glutamate receptor activity	NAS	contributes to
GO:0032279	asymmetric synapse	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0098794	postsynapse	TAS	cellular component
GO:0009897	external side of plasma membrane	TAS	cellular component
GO:0014069	postsynaptic density	ISS	cellular component
GO:0014069	postsynaptic density	ISS	cellular component
GO:0043197	dendritic spine	NAS	cellular component
GO:0098843	postsynaptic endocytic zone	NAS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0060076	excitatory synapse	NAS	cellular component
GO:0035249	synaptic transmission, glutamatergic	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1904315	transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential	IBA	molecular function
GO:0098839	postsynaptic density membrane	IBA	cellular component
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0035249	synaptic transmission, glutamatergic	IBA	biological process
GO:0015276	ligand-gated ion channel activity	IBA	molecular function
GO:0050804	modulation of chemical synaptic transmission	IBA	biological process
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0043197	dendritic spine	IBA	cellular component
GO:0032281	AMPA glutamate receptor complex	IBA	cellular component
GO:0008066	glutamate receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0004971	AMPA glutamate receptor activity	IBA	molecular function
GO:0004970	ionotropic glutamate receptor activity	IDA	molecular function
GO:0035235	ionotropic glutamate receptor signaling pathway	IDA	biological process
GO:0032281	AMPA glutamate receptor complex	ISS	cellular component
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0004971	AMPA glutamate receptor activity	ISS	molecular function
GO:0004970	ionotropic glutamate receptor activity	IEA	molecular function
GO:0015276	ligand-gated ion channel activity	IEA	molecular function
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004971	AMPA glutamate receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:2000310	regulation of NMDA receptor activity	TAS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098839	postsynaptic density membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa05016	Huntington disease
hsa04024	cAMP signaling pathway
hsa04723	Retrograde endocannabinoid signaling
hsa05017	Spinocerebellar ataxia
hsa04728	Dopaminergic synapse
hsa04724	Glutamatergic synapse
hsa04713	Circadian entrainment
hsa04720	Long-term potentiation
hsa05031	Amphetamine addiction
hsa05030	Cocaine addiction
hsa04730	Long-term depression
hsa05014	Amyotrophic lateral sclerosis
hsa05033	Nicotine addiction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray