• Gene id: 2887

Gene Summary

• Gene Symbol: GRB10   Gene   UCSC   Ensembl
• Aliases: GRB-IR, Grb-10, IRBP, MEG1, RSS
• Gene name: growth factor receptor bound protein 10
• Alternate names: growth factor receptor-bound protein 10, GRB10 adapter protein, GRB10 adaptor protein, insulin receptor-binding protein Grb-IR, maternally expressed gene 1,
• Gene location: 7p12.1 (46941854: 46901869)     Exons: 7     NC_000002.12
• Gene summary(Entrez): The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin re
• OMIM: 601523

Protein Summary

• Protein general information: Q13322  
  • Name: Growth factor receptor bound protein 10 (GRB10 adapter protein) (Insulin receptor binding protein Grb IR)
  • Length: 594  
  • Mass: 67231
  • Tissue specificity: Widely expressed in fetal and adult tissues, including fetal and postnatal liver, lung, kidney, skeletal muscle, heart, spleen, skin and brain. {ECO
• Sequence:

  MALAGCPDSFLHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMNASLESLYSACSMQSD
  TVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAIPNPFPELCGPGS
  PPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLE
  DHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVK
  ELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAGRKQYNAPTDHGLCIKPNKVRNETKE
  LRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYRIPQQRKALLSPFSTPVRSVSENSLVAMDFSGQTGRVIENPAE
  AQSAALEEGHAWRKRSTRMNILGSQSPLHPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSN
  PKAFVLTLCHHQKIKNFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL

• Structural information:
  • Protein Domains: (166..25-)
    (/note="Ras-associating-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00166-)
    (290..39-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (493..57-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191"-)
  • Interpro: IPR015042  IPR039664  IPR035036  IPR035037  IPR011993   IPR039665  IPR001849  IPR000159  IPR000980  IPR036860  IPR029071  
  • Prosite: PS50003 PS50200 PS50001
  • CDD: cd01259 cd10415
  • PDB: 1NRV 3HK0
  • PDBsum: 1NRV 3HK0
  • DIP: 31657
  • STRING: ENSP00000381793
• Other Databases: GeneCards:  GRB10  Malacards:  GRB10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0008286	insulin receptor signaling pathway	IBA	biological process
GO:0005158	insulin receptor binding	IBA	molecular function
GO:0030178	negative regulation of Wnt signaling pathway	IBA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0005158	insulin receptor binding	IEA	molecular function
GO:0046627	negative regulation of insulin receptor signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007411	axon guidance	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005158	insulin receptor binding	ISS	molecular function
GO:0046325	negative regulation of glucose import	ISS	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq