• Gene id: 2886

Gene Summary

• Gene Symbol: GRB7   Gene   UCSC   Ensembl
• Gene name: growth factor receptor bound protein 7
• Alternate names: growth factor receptor-bound protein 7, B47, GRB7 adapter protein, epidermal growth factor receptor GRB-7,
• Gene location: 17q12 (39737937: 39747284)     Exons: 23     NC_000017.11
• Gene summary(Entrez): The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal
• OMIM: 601522

Protein Summary

• Protein general information: Q14451  
  • Name: Growth factor receptor bound protein 7 (B47) (Epidermal growth factor receptor GRB 7) (GRB7 adapter protein)
  • Length: 532  
  • Mass: 59681
• Sequence:

  MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELC
  SPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSDETWGLVECHP
  HLALERGLEDHESVVEVQAAWPVGGDSRFVFRKNFAKYELFKSSPHSLFPEKMVSSCLDAHTGISHEDLIQNFLN
  AGSFPEIQGFLQLRGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPTDFG
  FCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQSRHLHPSCLGSPPLRSASDNTLVAM
  DFSGHAGRVIENPREALSVALEEAQAWRKKTNHRLSLPMPASGTSLSAAIHRTQLWFHGRISREESQRLIGQQGL
  VDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRH
  CCTRVAL

• Structural information:
  • Protein Domains: (100..18-)
    (/note="Ras-associating-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00166-)
    (229..33-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (431..52-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191"-)
  • Interpro: IPR015042  IPR039664  IPR035032  IPR011993  IPR039665   IPR001849  IPR000159  IPR000980  IPR036860  IPR029071  
  • Prosite: PS50003 PS50200 PS50001
  • CDD: cd01259
  • PDB: 1MW4 1WGR 2L4K 2QMS 3PQZ 4WWQ 4X6S 5D0J 5EEL 5EEQ 5TYI 5U06 5U1Q
  • PDBsum: 1MW4 1WGR 2L4K 2QMS 3PQZ 4WWQ 4X6S 5D0J 5EEL 5EEQ 5TYI 5U06 5U1Q
  • DIP: 502
  • STRING: ENSP00000403459
• Other Databases: GeneCards:  GRB7  Malacards:  GRB7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008286	insulin receptor signaling pathway	IBA	NOT|biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IBA	NOT|biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0035091	phosphatidylinositol binding	IDA	molecular function
GO:0019901	protein kinase binding	IDA	molecular function
GO:0005925	focal adhesion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0034063	stress granule assembly	ISS	biological process
GO:0017148	negative regulation of translation	ISS	biological process
GO:0010494	cytoplasmic stress granule	ISS	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0007173	epidermal growth factor receptor signaling pathway	TAS	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038128	ERBB2 signaling pathway	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0017148	negative regulation of translation	IEA	biological process
GO:0034063	stress granule assembly	IEA	biological process
GO:0005925	focal adhesion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881