• Gene id: 2882

Gene Summary

• Gene Symbol: GPX7   Gene   UCSC   Ensembl
• Aliases: CL683, GPX6, GPx-7, GSHPx-7, NPGPx
• Gene name: glutathione peroxidase 7
• Alternate names: glutathione peroxidase 7, glutathione peroxidase 6, non-selenocysteine containing phospholipid hydroperoxide glutathione peroxidase,
• Gene location: 1p32.3 (52602370: 52609050)     Exons: 3     NC_000001.11
• OMIM: 605732

Protein Summary

• Protein general information: Q96SL4  
  • Name: Glutathione peroxidase 7 (GPx 7) (GSHPx 7) (EC 1.11.1.9) (CL683)
  • Length: 187  
  • Mass: 20996
  • Tissue specificity: Expressed in esophageal epithelial cells; expression is up-regulated after exposure to acidic bile acids. {ECO
• Sequence:

  MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLG
  PHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVA
  PDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL

• Structural information:
  • Interpro: IPR013376  IPR000889  IPR029759  IPR029760  IPR036249  
  • Prosite: PS00460 PS00763 PS51355
  • CDD: cd00340
  • PDB: 2P31
  • PDBsum: 2P31
  • STRING: ENSP00000354677
• Other Databases: GeneCards:  GPX7  Malacards:  GPX7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004096	catalase activity	IDA	molecular function
GO:0004601	peroxidase activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004602	glutathione peroxidase activity	IEA	molecular function
GO:0006979	response to oxidative stress	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0004601	peroxidase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004602	glutathione peroxidase activity	IEA	molecular function
GO:0004601	peroxidase activity	EXP	molecular function
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0034599	cellular response to oxidative stress	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05016	Huntington disease
hsa04918	Thyroid hormone synthesis
hsa00590	Arachidonic acid metabolism
hsa05014	Amyotrophic lateral sclerosis
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881