• Gene id: 2878

Gene Summary

• Gene Symbol: GPX3   Gene   UCSC   Ensembl
• Aliases: GPx-P, GSHPx-3, GSHPx-P
• Gene name: glutathione peroxidase 3
• Alternate names: glutathione peroxidase 3, GPx-3, extracellular glutathione peroxidase, glutathione peroxidase 3 (plasma), plasma glutathione peroxidase,
• Gene location: 5q33.1 (151020590: 151028987)     Exons: 6     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozy
• OMIM: 138321

Protein Summary

• Protein general information: P22352  
  • Name: Glutathione peroxidase 3 (GPx 3) (GSHPx 3) (EC 1.11.1.9) (Extracellular glutathione peroxidase) (Plasma glutathione peroxidase) (GPx P) (GSHPx P)
  • Length: 226  
  • Mass: 25552
  • Tissue specificity: Secreted in plasma.
• Sequence:

  MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGL
  TGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYT
  FLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKR
  K

• Structural information:
  • Interpro: IPR000889  IPR029759  IPR029760  IPR036249  
  • Prosite: PS00460 PS00763 PS51355
  • CDD: cd00340
  • PDB: 2R37
  • PDBsum: 2R37
  • STRING: ENSP00000373477
• Other Databases: GeneCards:  GPX3  Malacards:  GPX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0004601	peroxidase activity	IBA	molecular function
GO:0042744	hydrogen peroxide catabolic process	IBA	biological process
GO:0008430	selenium binding	IBA	molecular function
GO:0004602	glutathione peroxidase activity	IBA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004602	glutathione peroxidase activity	IEA	molecular function
GO:0006979	response to oxidative stress	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0004601	peroxidase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004602	glutathione peroxidase activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0034599	cellular response to oxidative stress	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004602	glutathione peroxidase activity	IEA	molecular function
GO:0042744	hydrogen peroxide catabolic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0008430	selenium binding	IDA	molecular function
GO:0008430	selenium binding	IDA	molecular function
GO:0004602	glutathione peroxidase activity	IDA	molecular function
GO:0004602	glutathione peroxidase activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042744	hydrogen peroxide catabolic process	TAS	biological process
GO:0008134	transcription factor binding	TAS	molecular function
GO:0006982	response to lipid hydroperoxide	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05016	Huntington disease
hsa04918	Thyroid hormone synthesis
hsa00590	Arachidonic acid metabolism
hsa05014	Amyotrophic lateral sclerosis
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
Nephrotic syndrome	PMID:12824952
type 2 diabetes mellitus	PMID:18936159
type 2 diabetes mellitus	PMID:18936159
type 1 diabetes mellitus	PMID:16489975
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881