• Gene id: 2877

Gene Summary

• Gene Symbol: GPX2   Gene   UCSC   Ensembl
• Aliases: GI-GPx, GPRP, GPRP-2, GPx-2, GPx-GI, GSHPX-GI, GSHPx-2
• Gene name: glutathione peroxidase 2
• Alternate names: glutathione peroxidase 2, gastrointestinal glutathione peroxidase, glutathione peroxidase 2 (gastrointestinal), glutathione peroxidase-related protein 2,
• Gene location: 14q23.3 (64942744: 64939157)     Exons: 4     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozy
• OMIM: 138319

Protein Summary

• Protein general information: P18283  
  • Name: Glutathione peroxidase 2 (GPx 2) (GSHPx 2) (EC 1.11.1.9) (Gastrointestinal glutathione peroxidase) (Glutathione peroxidase gastrointestinal) (GPx GI) (GSHPx GI) (Glutathione peroxidase related protein 2) (GPRP 2)
  • Length: 190  
  • Mass: 21954
  • Tissue specificity: Mostly in liver and gastrointestinal tract, not found in heart or kidney.
• Sequence:

  MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQE
  NCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDV
  AWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI

• Structural information:
  • Interpro: IPR000889  IPR029759  IPR029760  IPR036249  
  • Prosite: PS00460 PS00763 PS51355
  • CDD: cd00340
  • PDB: 2HE3
  • PDBsum: 2HE3
  • STRING: ENSP00000374265
• Other Databases: GeneCards:  GPX2  Malacards:  GPX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004601	peroxidase activity	IBA	molecular function
GO:0004602	glutathione peroxidase activity	IBA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004602	glutathione peroxidase activity	IEA	molecular function
GO:0006979	response to oxidative stress	IEA	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004602	glutathione peroxidase activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0004602	glutathione peroxidase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0034599	cellular response to oxidative stress	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0022900	electron transport chain	IEA	biological process
GO:0009055	electron transfer activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05016	Huntington disease
hsa04918	Thyroid hormone synthesis
hsa00590	Arachidonic acid metabolism
hsa05014	Amyotrophic lateral sclerosis
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881