• Gene id: 2876

Gene Summary

• Gene Symbol: GPX1   Gene   UCSC   Ensembl
• Aliases: GPXD, GSHPX1
• Gene name: glutathione peroxidase 1
• Alternate names: glutathione peroxidase 1, GSHPx-1, cellular glutathione peroxidase,
• Gene location: 3p21.31 (49358599: 49357170)     Exons: 2     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Other studies
• OMIM: 138320

Protein Summary

• Protein general information: P07203  
  • Name: Glutathione peroxidase 1 (GPx 1) (GSHPx 1) (EC 1.11.1.9) (Cellular glutathione peroxidase)
  • Length: 203  
  • Mass: 22,088
• Sequence:

  MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLG
  FPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLI
  TWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA

• Structural information:
  • Interpro: IPR000889  IPR029759  IPR029760  IPR036249  
  • Prosite: PS00460 PS00763 PS51355
  • CDD: cd00340
  • PDB: 2F8A
  • PDBsum: 2F8A
  • STRING: ENSP00000407375
• Other Databases: GeneCards:  GPX1  Malacards:  GPX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0001659	temperature homeostasis	IEA	biological process
GO:0001885	endothelial cell development	IEA	biological process
GO:0002862	negative regulation of inflammatory response to antigenic stimulus	IEA	biological process
GO:0004602	glutathione peroxidase activity	IDA	molecular function
GO:0004602	glutathione peroxidase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	TAS	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006195	purine nucleotide catabolic process	TAS	biological process
GO:0006641	triglyceride metabolic process	IEA	biological process
GO:0006749	glutathione metabolic process	IDA	biological process
GO:0007605	sensory perception of sound	IEA	biological process
GO:0008631	intrinsic apoptotic signaling pathway in response to oxidative stress	IEA	biological process
GO:0009410	response to xenobiotic stimulus	IEA	biological process
GO:0009609	response to symbiotic bacterium	IEA	biological process
GO:0009650	UV protection	IMP	biological process
GO:0010269	response to selenium ion	IMP	biological process
GO:0010332	response to gamma radiation	IEA	biological process
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0018158	protein oxidation	IEA	biological process
GO:0019372	lipoxygenase pathway	TAS	biological process
GO:0033194	response to hydroperoxide	IEA	biological process
GO:0033599	regulation of mammary gland epithelial cell proliferation	IMP	biological process
GO:0034599	cellular response to oxidative stress	NAS	biological process
GO:0040029	regulation of gene expression, epigenetic	IDA	biological process
GO:0042311	vasodilation	IEA	biological process
GO:0042542	response to hydrogen peroxide	IMP	biological process
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0043403	skeletal muscle tissue regeneration	IEA	biological process
GO:0043523	regulation of neuron apoptotic process	IEA	biological process
GO:0043534	blood vessel endothelial cell migration	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0045454	cell redox homeostasis	IDA	biological process
GO:0048741	skeletal muscle fiber development	IEA	biological process
GO:0051450	myoblast proliferation	IEA	biological process
GO:0051702	interaction with symbiont	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0060047	heart contraction	IMP	biological process
GO:0060055	angiogenesis involved in wound healing	IEA	biological process
GO:0061136	regulation of proteasomal protein catabolic process	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0090201	negative regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	biological process
GO:1902176	negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IEA	biological process
GO:1902905	positive regulation of supramolecular fiber organization	ISS	biological process
GO:0097413	Lewy body	IDA	cellular component
GO:0000302	response to reactive oxygen species	IEA	biological process
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0001659	temperature homeostasis	IEA	biological process
GO:0001885	endothelial cell development	IEA	biological process
GO:0002862	negative regulation of inflammatory response to antigenic stimulus	IEA	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0004602	glutathione peroxidase activity	IEA	molecular function
GO:0004602	glutathione peroxidase activity	IEA	molecular function
GO:0004602	glutathione peroxidase activity	IDA	molecular function
GO:0004602	glutathione peroxidase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	TAS	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006195	purine nucleotide catabolic process	TAS	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006641	triglyceride metabolic process	IEA	biological process
GO:0006749	glutathione metabolic process	IDA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0007605	sensory perception of sound	IEA	biological process
GO:0008283	cell proliferation	IEA	biological process
GO:0008631	intrinsic apoptotic signaling pathway in response to oxidative stress	IEA	biological process
GO:0009410	response to xenobiotic stimulus	IEA	biological process
GO:0009609	response to symbiotic bacterium	IEA	biological process
GO:0009611	response to wounding	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0009650	UV protection	IMP	biological process
GO:0010269	response to selenium ion	IMP	biological process
GO:0010332	response to gamma radiation	IEA	biological process
GO:0014902	myotube differentiation	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0018158	protein oxidation	IEA	biological process
GO:0019372	lipoxygenase pathway	TAS	biological process
GO:0033194	response to hydroperoxide	IEA	biological process
GO:0033599	regulation of mammary gland epithelial cell proliferation	IMP	biological process
GO:0034599	cellular response to oxidative stress	NAS	biological process
GO:0040029	regulation of gene expression, epigenetic	IDA	biological process
GO:0042311	vasodilation	IEA	biological process
GO:0042542	response to hydrogen peroxide	IMP	biological process
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0043403	skeletal muscle tissue regeneration	IEA	biological process
GO:0043523	regulation of neuron apoptotic process	IEA	biological process
GO:0043534	blood vessel endothelial cell migration	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0045454	cell redox homeostasis	IDA	biological process
GO:0048741	skeletal muscle fiber development	IEA	biological process
GO:0051450	myoblast proliferation	IEA	biological process
GO:0051702	interaction with symbiont	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0060047	heart contraction	IMP	biological process
GO:0060055	angiogenesis involved in wound healing	IEA	biological process
GO:0061136	regulation of proteasomal protein catabolic process	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0090201	negative regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	biological process
GO:1902176	negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IEA	biological process
GO:1902905	positive regulation of supramolecular fiber organization	ISS	biological process
GO:0097413	Lewy body	IDA	cellular component
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0004602	glutathione peroxidase activity	IDA	molecular function
GO:0004602	glutathione peroxidase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	TAS	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006195	purine nucleotide catabolic process	TAS	biological process
GO:0006749	glutathione metabolic process	IDA	biological process
GO:0009650	UV protection	IMP	biological process
GO:0010269	response to selenium ion	IMP	biological process
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0019372	lipoxygenase pathway	TAS	biological process
GO:0033599	regulation of mammary gland epithelial cell proliferation	IMP	biological process
GO:0034599	cellular response to oxidative stress	NAS	biological process
GO:0040029	regulation of gene expression, epigenetic	IDA	biological process
GO:0042542	response to hydrogen peroxide	IMP	biological process
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0045454	cell redox homeostasis	IDA	biological process
GO:0060047	heart contraction	IMP	biological process
GO:0061136	regulation of proteasomal protein catabolic process	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0090201	negative regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	biological process
GO:1902905	positive regulation of supramolecular fiber organization	ISS	biological process
GO:0097413	Lewy body	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04918	Thyroid hormone synthesis
hsa05014	Amyotrophic lateral sclerosis
hsa05016	Huntington disease

Diseases

Associated diseases	References
Cancer	GAD: 19692168
Cancer (Adenoma)	GAD: 18483336
Cancer (basal cell)	GAD: 20727719
Cancer (bladder)	GAD: 15247771
Cancer (brain)	GAD: 19505917
Cancer (cervical)	GAD: 19012493
Cancer (colorectal)	GAD: 15946795
Cancer (head and neck)	GAD: 15878749
Cancer (lung)	GAD: 12234692
Cancer (lymphoma)	GAD: 17149600
Cancer (mouth)	GAD: 20643115
Cancer (non-Hodgkin lymphoma)	GAD: 16543247
Cancer (prostate)	GAD: 12496980
Cancer (breast)	GAD: 14744747
Aneurysm	GAD: 18600213
Atherosclerosis	GAD: 12655278
Cardiovascular disease	GAD: 18541150
Cerebral Hemorrhage	GAD: 18417962
Hypertension	GAD: 15167446
Atherosclerosis	GAD: 15167446
Diabetic neuropathy	GAD: 16523188
Macular degeneration	GAD: 15774926
Anemia	KEGG: H00668
Hodgkin disease	GAD: 19573080
Asthma	GAD: 17526193
Crohn's disease	GAD: 20307617
Metabolic syndrome	GAD: 18541588
Hemolytic anemia due to glutathione peroxidase deficiency	OMIM: 138320
Diabetes	GAD: 12732844
Degenerative arthropathy	GAD: 20178852
Dyskinesias	GAD: 20041472
Stroke	GAD: 11112379
Alzheimer's disease	GAD: 20724907
Autism	GAD: 19195803
Schizophrenia	GAD: 18449862
Chronic renal failure	GAD: 21085059
Kidney diseases	GAD: 19578796
Pregnancy complications	GAD: 20301895
Endometriosis	INFBASE: 11082967
Endometriosis	INFBASE: 10927050
Gonad development	INFBASE: 15120973
Unexplained infertility	INFBASE: 11082967
Asthenozoospermia	MIK: 22211112
Oligoasthenoteratozoospermia	MIK: 22211112
Male factor infertility	MIK: 18068167
Oligoasthenozoospermia	MIK: 19517995
Teratozoospermia	MIK: 22296823
Male factor infertility	MIK: 24082556
Oligozoospermia	MIK: 22296823
Varicocele	MIK: 18264794
Azoospermia	MIK: 18068167
Adenomyosis	INFBASE: 10927050
Chronic obstructive pulmonary disease (COPD)	GAD: 19705749
Calcinosis	GAD: 17825092
Asthenozoospermia	MIK: 22211112
Oligoasthenoteratozoospermia	MIK: 22211112
Oligozoospermia	MIK: 22296823
Teratozoospermia	MIK: 22296823
Azoospermia	MIK: 18068167
Hypospermatogenesis	MIK: 28361989
Idiopathic oligoasthenozoospermia	MIK: 19517995
Male infertility	MIK: 12553559
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18068167	Azoospermia, Male infertility			6 (3 fertile men with normal spermatogenesis, 3 azoospermic patients)	Male infertility	phospholipid hydroperoxide glutathione peroxidase peroxiredoxin 4 (Prx4) heat shock protein beta-1 (HSP27) and cathepsin D (CTSD)
24082556	Male infertility		Northea st Indi a	70 (50 infertile individuals, 20 fertile donors)	Male infertility
22211112	Asthenozoospermia, oligoasthenoteratozoospermia		Tunisia n	115 (40 controls, 45 asthenozoospermics, 35 oligoasthenoteratozoospermics)	Male infertility
19517995	Idiopathic oligoasthenozoospermic			63 (33 infertile oligo-asthenozoospermic (OA) men, 30 fertile controls)	Male infertility
26027266	Male infertility			90 (60 men with infertility were examined--30 with normal weight and 30 with overweight), 30fertile men)	Male infertility	GSH GR GPO GST
12553559	Male infertility				Male infertility
22296823	Asthenozoospermia, oligozoospermia, and teratozoospermia			300 males from infertile couples	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray