• Gene id: 2874

Gene Summary

• Gene Symbol: GPS2   Gene   UCSC   Ensembl
• Aliases: AMF-1
• Gene name: G protein pathway suppressor 2
• Alternate names: G protein pathway suppressor 2, GPS-2,
• Gene location: 17p13.1 (7315359: 7312660)     Exons: 6     NC_000017.11
• Gene summary(Entrez): This gene encodes a protein involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this gene could potently suppress a RAS- and MAPK-mediated signal and interfere with JNK activity, suggest
• OMIM: 601935

Protein Summary

• Protein general information: Q13227  
  • Name: G protein pathway suppressor 2 (GPS 2)
  • Length: 327  
  • Mass: 36689
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLEEK
  LLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNRPGTLMAADRA
  KQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQP
  QPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGK
  SGFAATSQPGPRLPFIQHSQNPRFYHK

• Structural information:
  • Interpro: IPR026094  
  • PDB: 2L5G
  • PDBsum: 2L5G
  • DIP: 34427
  • STRING: ENSP00000370104
• Other Databases: GeneCards:  GPS2  Malacards:  GPS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010875	positive regulation of cholesterol efflux	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0045599	negative regulation of fat cell differentiation	ISS	biological process
GO:0030183	B cell differentiation	ISS	biological process
GO:0019216	regulation of lipid metabolic process	ISS	biological process
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900045	negative regulation of protein K63-linked ubiquitination	ISS	biological process
GO:0098780	response to mitochondrial depolarisation	ISS	biological process
GO:0050859	negative regulation of B cell receptor signaling pathway	ISS	biological process
GO:0050728	negative regulation of inflammatory response	ISS	biological process
GO:0045598	regulation of fat cell differentiation	ISS	biological process
GO:0035360	positive regulation of peroxisome proliferator activated receptor signaling pathway	ISS	biological process
GO:0034122	negative regulation of toll-like receptor signaling pathway	ISS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005095	GTPase inhibitor activity	TAS	molecular function
GO:0000188	inactivation of MAPK activity	TAS	biological process
GO:0007254	JNK cascade	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IEA	biological process
GO:0019216	regulation of lipid metabolic process	IEA	biological process
GO:0030183	B cell differentiation	IEA	biological process
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0017053	transcription repressor complex	IEA	cellular component
GO:0034122	negative regulation of toll-like receptor signaling pathway	IEA	biological process
GO:0035360	positive regulation of peroxisome proliferator activated receptor signaling pathway	IEA	biological process
GO:0045598	regulation of fat cell differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0046329	negative regulation of JNK cascade	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0050859	negative regulation of B cell receptor signaling pathway	IEA	biological process
GO:0098780	response to mitochondrial depolarisation	IEA	biological process
GO:1900045	negative regulation of protein K63-linked ubiquitination	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0046329	negative regulation of JNK cascade	IDA	biological process
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030332	cyclin binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Male factor infertility	MIK: 29961538
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray