• Gene id: 2872

Gene Summary

• Gene Symbol: MKNK2   Gene   UCSC   Ensembl
• Aliases: GPRK7, MNK2
• Gene name: MAPK interacting serine/threonine kinase 2
• Alternate names: MAP kinase-interacting serine/threonine-protein kinase 2, G protein-coupled receptor kinase 7, MAP kinase interacting serine/threonine kinase 2, MAP kinase signal-integrating kinase 2, MAPK signal-integrating kinase 2,
• Gene location: 19p13.3 (31870672: 31475397)     Exons: 14     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the calcium/calmodulin-dependent protein kinases (CAMK) Ser/Thr protein kinase family, which belongs to the protein kinase superfamily. This protein contains conserved DLG (asp-leu-gly) and ENIL (glu-asn-ile-leu) motifs, and
• OMIM: 605069

Protein Summary

• Protein general information: Q9HBH9  
  • Name: MAP kinase interacting serine/threonine protein kinase 2 (EC 2.7.11.1) (MAP kinase signal integrating kinase 2) (MAPK signal integrating kinase 2) (Mnk2)
  • Length: 465  
  • Mass: 51875
  • Tissue specificity: Ubiquitously expressed in all tissues examined. Isoform 2 is expressed at higher levels in the ovary than is isoform 1. {ECO
• Sequence:

  MVQKKPAELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSF
  SGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPGHIRSRVFREVEMLYQCQGHRNVLELIEFFE
  EEDRFYLVFEKMRGGSILSHIHKRRHFNELEASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKIC
  DFDLGSGIKLNGDCSPISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGRCG
  SDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLVRDAKQRLSAAQVLQHPWVQGCAPEN
  TLPTPMVLQRNSCAKDLTSFAAEAIAMNRQLAQHDEDLAEEEAAGQGQPVLVRATSRCLQLSPPSQSKLAQRRQR
  ASLSSAPVVLVGDHA

• Structural information:
  • Protein Domains: (84..38-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 2AC3 2AC5 2HW7 6CJ5 6CJE 6CJH 6CJW 6CJY 6CK3 6CK6 6CKI
  • PDBsum: 2AC3 2AC5 2HW7 6CJ5 6CJE 6CJH 6CJW 6CJY 6CK3 6CK6 6CKI
  • STRING: ENSP00000250896
• Other Databases: GeneCards:  MKNK2  Malacards:  MKNK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005516	calmodulin binding	IBA	molecular function
GO:0009931	calcium-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0046777	protein autophosphorylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0071243	cellular response to arsenic-containing substance	IDA	biological process
GO:0030097	hemopoiesis	IDA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0035556	intracellular signal transduction	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04910	Insulin signaling pathway
hsa04066	HIF-1 signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq