• Gene id: 2870

Gene Summary

• Gene Symbol: GRK6   Gene   UCSC   Ensembl
• Aliases: GPRK6
• Gene name: G protein-coupled receptor kinase 6
• Alternate names: G protein-coupled receptor kinase 6,
• Gene location: 5q35.3 (177426495: 177442890)     Exons: 18     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their de
• OMIM: 600869

Protein Summary

• Protein general information: P43250  
  • Name: G protein coupled receptor kinase 6 (EC 2.7.11.16) (G protein coupled receptor kinase GRK6)
  • Length: 576  
  • Mass: 65991
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQPIGRLLFREFCATRP
  ELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKDLFQELTRLTH
  EYLSVAPFADYLDSIYFNRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKR
  KGEAMALNEKQILEKVNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQAGFPEARAVFYAAEICCGLE
  DLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVKNERYTFSPDWWALGCLL
  YEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLCSQLLCKDPAERLGCRGGSAREVKEHPLFKK
  LNFKRLGAGMLEPPFKPDPQAIYCKDVLDIEQFSTVKGVELEPTDQDFYQKFATGSVPIPWQNEMVETECFQELN
  VFGLDGSVPPDLDWKGQPPAPPKKGLLQRLFSRQDCCGNCSDSEEELPTRL

• Structural information:
  • Protein Domains: (53..17-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171-)
    (186..44-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (449..51-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR000239  IPR011009  IPR000719  IPR017441   IPR016137  IPR036305  IPR008271  
  • Prosite: PS51285 PS00107 PS50011 PS00108 PS50132
  • PDB: 2ACX 3NYN 3NYO
  • PDBsum: 2ACX 3NYN 3NYO
  • STRING: ENSP00000433511
• Other Databases: GeneCards:  GRK6  Malacards:  GRK6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0047696	beta-adrenergic receptor kinase activity	IDA	molecular function
GO:0047696	beta-adrenergic receptor kinase activity	IMP	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004703	G protein-coupled receptor kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0008277	regulation of G protein-coupled receptor signaling pathway	TAS	biological process
GO:0004703	G protein-coupled receptor kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0047696	beta-adrenergic receptor kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04062	Chemokine signaling pathway
hsa05032	Morphine addiction

Diseases

Associated diseases	References
Parkinson's disease	PMID:22090514
Rheumatoid arthritis	PMID:10094932
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq