• Gene id: 2869

Gene Summary

• Gene Symbol: GRK5   Gene   UCSC   Ensembl
• Aliases: FP2025, GPRK5
• Gene name: G protein-coupled receptor kinase 5
• Alternate names: G protein-coupled receptor kinase 5, g protein-coupled receptor kinase GRK5,
• Gene location: 10q26.11 (18630845: 18748865)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their de
• OMIM: 600870

Protein Summary

• Protein general information: P34947  
  • Name: G protein coupled receptor kinase 5 (EC 2.7.11.16) (G protein coupled receptor kinase GRK5)
  • Length: 590  
  • Mass: 67787
  • Tissue specificity: Highest levels in heart, placenta, lung > skeletal muscle > brain, liver, pancreas > kidney. {ECO
• Sequence:

  MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLRRTIDRDYCSLCDKQPIGRLLFRQFCETRP
  GLECYIQFLDSVAEYEVTPDEKLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKELFSACAQSVH
  EYLRGEPFHEYLDSMFFDRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKR
  KGESMALNEKQILEKVNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLE
  DLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVGYMAPEVLNNQRYGLSPDYWGLGCLI
  YEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAKQRLGCQEEGAAEVKRHPFFRN
  MNFKRLEAGMLDPPFVPDPRAVYCKDVLDIEQFSTVKGVNLDHTDDDFYSKFSTGSVSIPWQNEMIETECFKELN
  VFGPNGTLPPDLNRNHPPEPPKKGLLQRLFKRQHQNNSKSSPSSKTSFNHHINSNHVSSNSTGSS

• Structural information:
  • Protein Domains: (53..17-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171-)
    (186..44-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (449..51-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR000239  IPR011009  IPR000719  IPR017441   IPR016137  IPR036305  
  • Prosite: PS51285 PS00107 PS50011 PS50132
  • PDB: 4TNB 4TND
  • PDBsum: 4TNB 4TND
  • DIP: 57457
  • STRING: ENSP00000376609
• Other Databases: GeneCards:  GRK5  Malacards:  GRK5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0047696	beta-adrenergic receptor kinase activity	IMP	molecular function
GO:0051726	regulation of cell cycle	IMP	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004703	G protein-coupled receptor kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005080	protein kinase C binding	TAS	molecular function
GO:0005543	phospholipid binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0008277	regulation of G protein-coupled receptor signaling pathway	TAS	biological process
GO:0004703	G protein-coupled receptor kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0047696	beta-adrenergic receptor kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045444	fat cell differentiation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007217	tachykinin receptor signaling pathway	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04062	Chemokine signaling pathway
hsa05032	Morphine addiction

Diseases

Associated diseases	References
Parkinson's disease	PMID:17125886
congestive heart failure	PMID:26248277
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq