• Gene id: 286753

Gene Summary

• Gene Symbol: TRARG1   Gene   UCSC   Ensembl
• Aliases: BEC-1, DSPB1, IFITMD3, LOST1, TUSC5
• Gene name: trafficking regulator of GLUT4 (SLC2A4) 1
• Alternate names: trafficking regulator of GLUT4 1, brain endothelial cell derived gene-1, dispanin subfamily B member 1, interferon induced transmembrane protein domain containing 3, interferon-induced transmembrane domain-containing protein D3, located at seventeen p thirteen,
• Gene location: 17p13.3 (1279661: 1300977)     Exons: 3     NC_000017.11
• OMIM: 138244

Protein Summary

• Protein general information: Q8IXB3  
  • Name: Trafficking regulator of GLUT4 1 (Dispanin subfamily B member 1) (DSPB1) (Interferon induced transmembrane domain containing protein D3) (Protein located at seventeen p thirteen point three 1) (Tumor suppressor candidate 5)
  • Length: 177  
  • Mass: 19254
  • Tissue specificity: Expressed at high levels in heart, mammary gland, adrenal gland, stomach, smooth muscle and skeletal muscle, and at lower levels in brain and lung. Strongly down-regulated in lung cancer tissues, due to hypermethylation of the correspo
• Sequence:

  MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGLPFKAISEGHLEAPLP
  RSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLNLIPLIISIMSRSSMQQGNVDGARRLGRLAR
  LLSITLIIMGIVIIMVAVTVNFTVQKK

• Structural information:
  • Interpro: IPR007593  
  • STRING: ENSP00000329548
• Other Databases: GeneCards:  TRARG1  Malacards:  TRARG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IBA	cellular component
GO:0032869	cellular response to insulin stimulus	ISS	biological process
GO:0030659	cytoplasmic vesicle membrane	ISS	cellular component
GO:0099638	endosome to plasma membrane protein transport	ISS	biological process
GO:0072659	protein localization to plasma membrane	ISS	biological process
GO:0044381	glucose import in response to insulin stimulus	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0099638	endosome to plasma membrane protein transport	IEA	biological process
GO:0099500	vesicle fusion to plasma membrane	IEA	biological process
GO:0072659	protein localization to plasma membrane	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0044381	glucose import in response to insulin stimulus	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq